ESTScan Details for Unigene SGN-U573664

Score 
232
Direction 
Forward
Predicted Peptide Sequence 
MKGLAGRGPHVDAAAASEXMYPVPAFLSPSATVADRLAIRRVILLRKLLLRLKIEXKFQLHLTKENKLNTATYQKNAATAHDFELVRIQV
IHLFSSVFSFSTKLFFSLAFFNYCFVCFCLQTCVLKVQINCHGCMQKVKKLLRRIEGVYQVKMDVDEQVVIVSGNVDSATLIKKL
Predicted Coding Sequence 
ATGAAAGGACTAGCTGGTAGAGGGCCTCATGTTGATGCTGCAGCTGCTTCTGAGTXCATGTATCCGGTGCCTGCATTTCTCTCTCCTAGC
GCTACTGTGGCTGATAGGTTAGCCATTCGTAGGGTGATCCTTTTGAGGAAGTTATTACTAAGACTTAAAATAGAAATXAAGTTTCAACTT
CATTTGACCAAAGAGAACAAACTAAACACTGCTACTTACCAGAAAAATGCAGCTACTGCCCATGACTTTGAGCTTGTGAGAATTCAGGTC
ATTCACTTGTTCTCATCAGTTTTCTCATTTTCCACTAAATTATTTTTCTCTTTAGCCTTCTTTAACTACTGCTTTGTATGTTTTTGTTTA
CAGACTTGTGTTCTTAAAGTTCAGATCAACTGTCATGGATGCATGCAGAAGGTGAAGAAACTACTTAGAAGAATTGAAGGGGTTTATCAA
GTGAAAATGGATGTTGATGAACAAGTGGTCATAGTATCTGGGAATGTGGACTCAGCAACACTGATCAAGAAGCTA
Edits in Original Sequence 
GGAAAAAATGATATACTTTGCCTTGCACCCTTTATCTGAACTGTCAATCCTCATTTTTCTGAACTACTCAACTGGTCAAATCACACATTT
CTTACACCCTTCAACACCCCACCCCCCCCTAAACCACCTATCTAAAGAACACACTGACATTTTTGAGGGTCTGTTGTGTTTTGCACTGAG
(5')ATGAAAGGACTAGCTaGGTAGAGGGCCTCATGTTGATGCTGCAGCTGCTTCTGAGTXCATGTATCCGGTGCCTGCATTTCTCTCTC
CTAGCGCTACTGTGGCTGATAGGTTAGCCATTCGTAGGGTGATCCTTTTGAGGtAAGTTATTACTAAGACTTAAAATAGAAATXAAGTTT
CAACTTCATTTGACCAAAGAGAACAAACTAAACACTGCTACTTACCAGAAAAATGtCAGCTACTGCCCATGACTTTGAGCTTGTGAGAAT
TCAGGTCATTCACTTaGTTCTCATCAGTTTTCTCATTTTCCACTAAATTATTTTTCTCTTTAGCCTTCTTTAACTACTGCTTTGTATGTT
TTTGTTTACAGACTTGTGTTCTTAAAGTTCAGATCAACTGTCATGGATGCATGCAGAAGGTGAAGAAACTACTTAGAAGAATTGAAGGGG
TTTATCAAGTGAAAATGGATGTTGATGAACAAGTGGTCATAGTATCTGGGAATGTGGACTCAGCAACACTGATCAAGAAGCTA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan