ESTScan Details for Unigene SGN-U573760

Score 
1083
Direction 
Forward
Predicted Peptide Sequence 
MYSNFKEQAIEYVRQAVQEDNSGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITQKFTEYLRRAEEIRAVLDEGGSGPGPNGGDAAVI
AKPKTKPKDGEDGEDPEQSKLRAGLNSAIVREKPNVKWNDVAGLESAKQALQEAVILPVKFPQFFTGKRRPWRAFLLYGPPGTGKSYLAK
AVATEAESTFFSVSSSDLVSKWMGESEKLVSNLFQMARESAPSIIFVDEIDSLCGQRGEGNESEASRRIKTELLVQMQGVGHNDDKVLVL
AATNTPYSLDQAIRRRFDKRIYIPLPDLKARQHMFKVHLGDTPHNLNECDFEDLARKTEGFSGSDVSVCVKDVLFEPVRKTQDAVFFTQT
SNGTWIPCGPKQRGAVQTTMQELAAKGLASQIIPPPITKTDFDKVLARQRPTVSKSDLEVHDRFTRNLEKKVEEIDXVSDNYYAW
Predicted Coding Sequence 
ATGTATAGCAATTTCAAGGAGCAAGCAATTGAGTACGTAAGGCAAGCAGTGCAAGAGGACAATAGTGGAAACTATGCAAAGGCATTTCCG
TTGTATATGAATGCATTGGAGTACTTCAAGACCCATTTGAAGTACGAGAAGAATCCTAAGATTAAGGAGGCAATTACCCAGAAATTTACA
GAGTATTTACGCCGGGCGGAGGAGATTAGGGCTGTGTTGGATGAGGGTGGGAGTGGGCCTGGTCCAAATGGAGGAGATGCTGCTGTAATT
GCTAAGCCTAAGACTAAGCCTAAGGATGGTGAGGATGGTGAGGATCCTGAGCAGTCTAAGCTAAGGGCTGGGCTTAATTCAGCAATTGTT
AGAGAAAAACCTAATGTGAAGTGGAATGATGTTGCTGGATTGGAGAGTGCTAAACAGGCGTTGCAGGAAGCTGTCATTTTGCCTGTGAAA
TTCCCTCAGTTCTTCACAGGAAAGAGGCGACCATGGAGAGCTTTTCTTCTTTATGGTCCTCCTGGGACAGGAAAGTCTTACTTGGCGAAA
GCTGTTGCTACTGAAGCGGAATCCACTTTTTTTAGTGTCTCGTCATCAGACCTTGTATCCAAGTGGATGGGTGAAAGTGAAAAGCTAGTT
TCGAACCTCTTCCAAATGGCTCGAGAAAGCGCTCCATCCATTATATTTGTTGATGAAATTGATTCCTTGTGTGGGCAGCGAGGAGAAGGA
AATGAAAGTGAAGCTTCTCGACGTATTAAAACAGAACTCCTTGTGCAGATGCAGGGTGTTGGTCACAATGATGATAAAGTTCTTGTACTT
GCGGCAACAAATACACCCTATTCCCTAGATCAGGCTATACGGCGAAGATTTGATAAGCGTATCTACATTCCGCTCCCTGATTTGAAGGCA
CGGCAACACATGTTCAAAGTTCATTTAGGTGATACCCCCCATAACTTGAACGAGTGTGACTTTGAAGACCTGGCCCGTAAGACAGAAGGT
TTTTCTGGTTCAGATGTTTCTGTTTGTGTCAAGGACGTGCTATTTGAACCTGTACGTAAGACACAAGATGCTGTGTTCTTTACTCAAACT
TCTAATGGTACCTGGATTCCATGCGGACCGAAGCAACGGGGTGCTGTGCAGACAACTATGCAGGAACTTGCTGCTAAAGGACTCGCGTCC
CAGATCATCCCGCCACCCATTACAAAGACTGATTTTGATAAGGTTCTTGCTCGTCAAAGGCCAACAGTTAGTAAATCCGACCTTGAAGTG
CATGACAGATTCACAAGGAATTTGGAGAAGAAGGTTGAAGAGATTGATGXTGTTTCCGATAACTACTACGCCTGG
Edits in Original Sequence 
GCGACAAAGCACTTTTCCCCTGTAAATTCAACGTTCAAACTCACAAATTACGATTCTTTCAAATGTTTTCTTCTTTCATAATCCAACTTT
CGATCTCTAATCAATCTTTTTCTTAAGCCAAAACCAAAATCCCCAATTTTTAGGGTTCCTAATCCACCCAAAAAAGCTCAAAATCTTCAA
AAAGATCCATTTCTCAGAGCACTGTTTATTGGATATTTTTTCTTAAATCAACTTTTTTCGAATACCCTTTTGAGTTCTGATGAAAACCCA
TTAATTTTCTTGGTTAGTTTGGTAGTTTTTCAGACACCCTTTTGAGTTCTGATCAAACCCTGAAATTTGCTTGGTTAGTATTGTGGTTTA
TTTTATTTTATATGATCGAAG
(5')ATGTATAGCAATTTCAAGGAGCAAGCAATTGAGTACGTAAGGCAAGCAGTGCAAGAGGACAATAG
TGGAAACTATGCAAAGGCATTTCCGTTGTATATGAATGCATTGGAGTACTTCAAGACCCATTTGAAGTACGAGAAGAATCCTAAGATTAA
GGAGGCAATTACCCAGAAATTTACAGAGTATTTACGCCGGGCGGAGGAGATTAGGGCTGTGTTGGATGAGGGTGGGAGTGGGCCTGGTCC
AAATGGAGGAGATGCTGCTGTAATTGCTAAGCCTAAGACTAAGCCTAAGGATGGTGAGGATGGTGAGGATCCTGAGCAGTCTAAGCTAAG
GGCTGGGCTTAATTCAGCAATTGTTAGAGAAAAACCTAATGTGAAGTGGAATGATGTTGCTGGATTGGAGAGTGCTAAACAGGCGTTGCA
GGAAGCTGTCATTTTGCCTGTGAAATTCCCTCAGTTCTTCACAGGAAAGAGGCGACCATGGAGAGCTTTTCTTCTTTATGGTCCTCCTGG
GACAGGAAAGTCTTACTTGGCGAAAGCTGTTGCTACTGAAGCGGAATCCACTTTTTTTAGTGTCTCGTCATCAGACCTTGTATCCAAGTG
GATGGGTGAAAGTGAAAAGCTAGTTTCGAACCTCTTCCAAATGGCTCGAGAAAGCGCTCCATCCATTATATTTGTTGATGAAATTGATTC
CTTGTGTGGGCAGCGAGGAGAAGGAAATGAAAGTGAAGCTTCTCGACGTATTAAAACAGAACTCCTTGTGCAGATGCAGGGTGTTGGTCA
CAATGATGATAAAGTTCTTGTACTTGCGGCAACAAATACACCCTATTCCCTAGATCAGGCTATACGGCGAAGATTTGATAAGCGTATCTA
CATTCCGCTCCCTGATTTGAAGGCACGGCAACACATGTTCAAAGTTCATTTAGGTGATACCCCCCATAACTTGAACGAGTGTGACTTTGA
AGACCTGGCCCGTAAGACAGAAGGTTTTTCTGGTTCAGATGTTTCTGTTTGTGTCAAGGACGTGCTATTTGAACCTGTACGTAAGACACA
AGATGCTGTGTTCTTTACTCAAACTTCTAATGGTACCTGGATTCCATGCGGACCGAAGCAACGGGGTGCTGTGCAGACAACTATGCAGGA
ACTTGCTGCTAAAGGACTCGCGTCCCAGATCATCCCGCCACCCATTACAAAGACTGATTTTGATAAGGTTCTTGCTCGTCAAAGGCCAAC
AGTTAGTAAATCCGACCTTGAAGTGCATGACAGATTCACgAAGGAATTTGGAGAAGAAGGTTGAAGAGATTGATGXTGTTTCCGATAACT
ACTACGCCTGG(3')AGTTGCCGTGATTTGTATTTTTTCTCCCTTCTACTTGTCTGAAAAATTTGCGATTTTCAAAGGTTCTTCAAATGG
GAGAGATTGACATTGTTTACCTTCTTGGATTGTATCAGTTTTAGCTTTGCATGTATTTATCAATGTCAAGACAGAACATTTTGCTAGTAT
TTTTGTTGTATTTCCTTTTAAAATACTAATTGCAATTACTTTGTAATCATTTCA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan