Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U573835

Score 
192
Direction 
Forward
Predicted Peptide Sequence 
APKSKINMPIISTTSPRSFLQTPPPPVNIFSSGDNSLLSPSSVRFRQSGNFTTAAAAAATCASVETESTTSRYSTLPSDIIHASSAPIPE
AAGTSIYTPAAVLLQQCRHSPAILPGTGKQISAGALSII*
Predicted Coding Sequence 
GCACCAAAAAGTAAAATAAACATGCCCATCATATCTACTACTTCCCCTCGTTCGTTTCTTCAAACTCCGCCACCGCCGGTGAATATATTT
TCCTCCGGCGATAATTCTCTTCTATCACCGTCTTCCGTCAGATTCCGTCAGTCCGGTAACTTCACCACCGCCGCAGCGGCGGCGGCGACT
TGCGCTTCCGTCGAAACTGAATCTACCACGTCAAGGTACTCGACGCTGCCTTCTGACATTATCCATGCTTCTTCGGCGCCTATTCCGGAA
GCXGCCGGAACGTCAATTTATACTCCGGCGGCTGTTCTCCTTCAGCAATGTCGGCATTCACCGGCTATACTACCCGGAACTGGGAAACAG
ATCAGTGCTGGTGCTCTCTCCATCATTTAA
Edits in Original Sequence 
(5')GCACCAAAAAGTAAAATAAACATGCCCATCATATCTACTACTTCCCCTCGTTCGTTTCTTCAAACTCCGCCACCGCCGGTGAATAT
ATTTTCCTCCGGCGATAATTCTCTTCTATCACCGTCTTCCGTCAGATTCCGTCAGTCCGGTAACTTCACCACCGCCGCAGCGGCGGCGGC
GACTTGCGCTTCCGTCGAAACTGAATCTACCACGTCAAGGTACTCGACGCTGCCTTCTGACATTATCCATGCTTCTTCGGCGCCTATTCC
GGAAGCXGCCGGAACGTCAATTTATACTCCGGCGGCTGTTCTCCTTCAGCAATGTCGGCATTCACCGGCTATACTACCCGGAACTGGGAA
ACAGATCAGTGCTGGTaGCTCTCTCCATCATTTAA(3')AGCCTGTTGTATATTTTTCTGAGGCATAGTGGGAAAGAGATTTTTTAAACG
AAAAAAAAAATTAACTTAGATTTGCTATCTTTACTGTTATCTTATTAGAGTTTCTACTTGTATATGCTGATTAATACTGACATGAATTTC
AAATCTCAGAAAANAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan