Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U574224

Score 
10
Direction 
Forward
Predicted Peptide Sequence 
XGPFNHLARNEAGLPREWYDPSSSVEDKQKKLSQVYDRLECIIAMEKDNSSLNVHMDDSYIEELIXTWKKKLLTAANAPAKVKQAGPPIV
KGLXYLFDLTGPQPEHDFAVITQPSHVDYQTEPRLLIYNLEAXDVLQTRLALDLIDDAFSRDRTWHNVELFSSGGATYKVQ*
Predicted Coding Sequence 
XXGGGACCATTCAACCATTTGGCTAGAAATGAAGCTGGTCTTCCACGGGAATGGTATGACCCTTCTTCAAGTGTAGAAGATAAGCAAAAG
AAGTTATCTCAGGTTTATGATCGACTGGAATGCATAATTGCTATGGAAAAGGACAACTCGAGTCTAAATGTCCACATGGATGATTCCTAT
ATCGAGGAACTGATTGXTACTTGGAAGAAAAAATTACTGACAGCGGCAAATGCGCCTGCTAAAGTTAAACAAGCTGGTCCGCCAATTGTA
AAAGGACTTGXTTACCTCTTTGATCTCACAGGGCCACAACCTGAGCACGATTTTGCTGTCATCACTCAACCTAGTCACGTCGACTATCAA
ACAGAGCCTAGACTATTGATATACAATCTTGAAGCTXCTGATGTTTTGCAGACTAGATTGGCATTGGATTTGATTGATGATGCCTTTTCT
CGTGACAGAACCTGGCATAACGTCGAGCTCTTCAGCAGTGGCGGAGCCACATATAAGGTCCAGTAG
Edits in Original Sequence 
(5')XXGGGACCATTCAACCATTTGGCTAGAAATGAAGCTGGTCTTCCACGGGAATGGTATGACCCTTCTTCAAGTGTAGAAGATAAGCA
AAAGAAGTTATCTCAGGTTTATGATCGACTGGAATGCATAATTGCTATGGAAAAGGACAACTCGAGTCTAAATaGTCCACATGGATGATT
CCTATATCGAGGAACTGATTGXTACTTGGAAGAAAAAATTACTGACAGCGGCAAATGCGCCTGCTAAAGtTTAAACAAGCTGGTCCGCCA
ATTGTAAAAGGACTTGXTTACCTCTTTGATCTCACAGGGCCACAACCTGAGCACGATTTTGCTGTCATCACTCtAACCTAGTCACGTCGA
CTATCAAACAGAGCCTAGACTATTGATAtTACAATCTTGAAGCTXCTGATGTTTTGCAGACTAGATTGGCATTGGATTTGATTGATGATa
GCCTTTTCTCGTGACAGAACCTGGCATAACGTCGAGCTCTTCAGCAGTGGCGGAGCCACATATAAGGTCCAGTAG(3')AATCCCCTTCA
TCGAAAATTATACTGTACAAATAAGGTAAAACCAAATTTTCTTGTATGCATATAAATATCTGAATCCTCTTGATATATATAAATCTTAGT
GTGCTAGTGTGTATACATTCTGGCATTTTCTAGAATATCTTTAGCCGGCAGCCGTGCACTTGAGCCCAAGGATCTGTCGAAAACCACCTC
TCTACTTTCCCGAGGTAGGGGTAAGAGTACGTACATGTATCTCTCTCCGGATTTCATTTGTGGGAAATATTGGATATGTTGTTGTAGTTT
TACTCGTAGTCGAGAGCTGATAGGGAGTTCAACCTATGAGTTCATCCTAACTCACTAGCTCTGGCTTGAACCCTATTCACTTTTTAAGTG
CAAATGAGTTATGGTAAAATGTTTGAAACTCAATTCATGAAGTTTGAATTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan