ESTScan Details for Unigene SGN-U574242

Score 
576
Direction 
Reverse
Predicted Peptide Sequence 
DKKLNPKISAFVLPRLDVDDNNTHITTRVAGTIGYMAPEYALWGYLTYKADVYSFGVLALEIAAGKSNMTYRPNEKFVCLLDWALVLQRQ
GKLKEVVDATLGSDLNEDEALRMLNVALLCTSPSPALRPTMSAVVKILENHLDLPEFTMESRFYDDYDLFNFQGLRDKYEDTNESQPLTH
SSNTITTRDCSYTTSTSA*
Predicted Coding Sequence 
GACAAGAAACTAAATCCGAAAATCTCAGCTTTTGTCCTGCCCAGACTTGATGTTGATGATAACAACACACACATTACCACTAGAGTTGCC
GGAACCATAGGATATATGGCCCCTGAATATGCACTATGGGGTTACTTGACCTACAAAGCAGATGTCTACAGTTTTGGAGTTCTTGCATTA
GAGATTGCTGCTGGGAAAAGCAATATGACATATCGCCCCAATGAGAAATTTGTCTGCCTCCTAGATTGGGCTCTTGTTCTACAAAGACAA
GGAAAACTGAAGGAAGTAGTAGATGCAACATTGGGCAGTGATTTGAACGAGGACGAGGCTCTAAGGATGTTAAATGTAGCTTTGCTATGT
ACCAGTCCATCTCCAGCACTTAGGCCAACCATGTCTGCTGTAGTCAAAATTCTTGAAAATCATCTTGACCTCCCTGAGTTTACAATGGAA
TCAAGATTCTATGATGATTATGATCTTTTCAACTTTCAAGGGTTAAGAGACAAGTATGAAGATACAAACGAAAGCCAACCACTCACACAT
TCATCAAATACCATTACAACAAGAGATTGCTCTTACACTACCTCTACATCAGCTTAA
Edits in Original Sequence 
(5')GACAAGAAACTAAATCCGAAAATCTCAGCTTTTGTCCTGCCCAGACTTGATGTTGATGATAACAACACACACATTACCACTAGAGT
TGCCGGAACCATAGGATATATGGCCCCTGAATATGCACTATGGGGTTACTTGACCTACAAAGCAGATGTCTACAGTTTTGGAGTTCTTGC
ATTAGAGATTGCTGCTGGGAAAAGCAATATGACATATCGCCCCAATGAGAAATTTGTCTGCCTCCTAGATTGGGCTCTTGTTCTACAAAG
ACAAGGAAAACTGAAGGAAGTAGTAGATGCAACATTGGGCAGTGATTTGAACGAGGACGAGGCTCTAAGGATGTTAAATGTAGCTTTGCT
ATGTACCAGTCCATCTCCAGCACTTAGGCCAACCATGTCTGCTGTAGTCAAAATTCTTGAAAATCATCTTGACCTCCCTGAGTTTACAAT
GGAATCAAGATTCTATGATGATTATGATCTTTTCAACTTTCAAGGGTTAAGAGACAAGTATGAAGATACAAACGAAAGCCAACCACTCAC
ACATTCATCAAATACCATTACAACAAGAGATTGCTCTTACACTACCTCTACATCAGCTTAA(3')ATGTTCGCGAGACAATATTTTCTTG
GCGGTTTATCAAACATAAGATATTTGATTACACCCAAAAACAGTTTTTGTTGATTATTGAATCACAAAAATACAAATACACATTATGAAT
CTCTCAATCAATTGAAAAAATATATTTTCAATCAGATATCTCTTTGGGT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan