ESTScan Details for Unigene SGN-U574289

Score 
-269
Direction 
Forward
Predicted Peptide Sequence 
XGGAFKTQDPPKIAAVPISLLVCNXGETLAIVGESGSGKSVTALALMRLLEQAGGLVQCDXNAVAAAQCEVIELSEQNAAQMRHVRGADM
AMIFQEPMTSLNPVFTVGEQIAESIRLHQNASREEAMVEAKRMLDQVRIPEAQTILSRYPASTLWRDAPASDDCDGAVMPPAVLIADEPT
TALDVTIQAADPAIN
Predicted Coding Sequence 
XCTGGGGGGGCTTTTAAGACGCAGGACCCCCCCAAAATAGCTGCGGTCCCAATCTCTCTTTTAGTCTGCAACXGCGGTGAGACGCTGGCA
ATTGTTGGCGAATCCGGCTCCGGTAAGTCAGTGACTGCGTTGGCATTGATGCGCCTGTTGGAACAGGCGGGCGGTTTAGTACAGTGCGAT
AAXAATGCTGTTGCAGCGGCGCAGTGCGAAGTGATTGAACTTAGCGAGCAGAACGCTGCACAAATGCGCCATGTTCGCGGTGCGGATATG
GCGATGATATTTCAGGAGCCGATGACATCGCTGAACCCGGTATTTACTGTGGGTGAACAGATTGCCGAATCAATTCGTCTGCATCAGAAC
GCCAGTCGTGAAGAAGCGATGGTCGAGGCGAAGCGGATGCTGGATCAGGTACGCATTCCTGAGGCACAAACCATTCTTTCACGTTATCCX
GCATCAACTCTCTGGCGGGATGCGCCAGCGAGTGATGATTGCGATGGCGCTGTCATGCCGCCGGCGGTGCTGATTGCCGATGAGCCAACC
ACCGCGCTGGATGTCACTATTCAGGCXGCAGATCCTGCAATTAAT
Edits in Original Sequence 
(5')XCTGGGGGGGCTTTTAAGACGCAGGACCCCCCCAAAATAGCTGCGGTCCgCAATCTCTCTTTTAGTCTGCAACXGCGGTGAGACGC
TGGCAATTGTTGGCGAATCCGGCTCCGGTAAGTCAGTGACTGCGTTGGCATTGATGCGCCTGTTGGAACAGGCGGGCGGTTTAGTACAGT
GCGATAAXAATGCTGTTGCAGCGGCGCAGTcGCGAAGTGATTGAACTTAGCGAGCAGAACGCTGCACAAATGCGCCATGTTCGCGGTGCG
GATATGGCGATGATATTTCAGGAGCCGATGACATCGCTGAACCCGGTATTTACTGTGGGTGAACAGATTGCCGAATCAATTCGTCTGCAT
CAGAACGCCAGTCGTGAAGAAGCGATGGTCGAGGCGAAGCGGATGCTGGATCAGGTACGCATTCCTGAGGCACAAACCATTCTTTCACGT
TATCCXGCATCAACTCTCTGGCGGGATGCGCCAGCGAGTGATGATTGCGATGGCGCTGTCATGCCGcCCGGCGGTGCTGATTGCCGATGA
GCCAACCACCGCGCTGGATGTCACTATTCAGGCXGCAGATCCTGCAATTAAT(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan