ESTScan Details for Unigene SGN-U574353

Score 
-45
Direction 
Forward
Predicted Peptide Sequence 
MNTIFLSGANSXTQIPMDSISTSSQQRRIIEFFFVLASLISSSNLPLALHNSAKLSWALIRMDPCPFVRLSVCNLALKIPIASKPARSVV
HPSSSPCFCKIKLKNFPLQTAVVPCILPESQFPDGQVQSHAASFHLNKSDLEKLVAKSLFGGRKLYLQISIYTGRRGSTCGVNSGRLLGK
VDVPLDLAGTESRSVLFYNGWIVIGKEAKNSSAQFHLSVKAEPDPRFVFQFDGEPECSPQVFQIQGNIRQPVFTCKFSFRTPGDRNQRSR
SLPLEHSSSRGWLSSFGSERERPGKERKGWSITVHDLSGSPVAAASMVTPFVASPGSDRVSRSNPGSWLVLRPGDGTWKPWGRLEAWRER
GSADGLGYRFELIPDSAAAGIVLAESTLSCSKGGKFVIDLGTSVSTNGKSTPVNSTSPACSPRGSGDFGYGLWPYCMYRGFVMSANVEGE
GGSKCSKPTVEVSVQHVNCTEDAAAFVALSAAIDLSIDACRLFSQKLRKELCPSQDLLS*
Predicted Coding Sequence 
ATGAACACAATATTTTTAAGTGGAGCCAATTCTGXTACACAAATCCCTATGGACTCTATTTCAACTTCTTCTCAACAACGGCGCATAATA
GAGTTTTTCTTTGTCCTAGCTTCGCTTATTAGTTCTTCAAATTTGCCTTTAGCTTTACACAACTCGGCGAAACTAAGTTGGGCACTAATT
AGAATGGATCCATGTCCTTTCGTGAGGCTCAGTGTGTGTAATTTAGCGTTAAAAATTCCGATAGCTTCGAAGCCGGCTCGTTCCGTTGTG
CATCCGTCGTCGTCGCCGTGTTTTTGTAAAATCAAGTTGAAGAATTTTCCTCTCCAGACGGCGGTTGTGCCGTGCATTTTGCCGGAGAGT
CAGTTTCCCGACGGTCAGGTACAAAGTCATGCGGCGAGTTTTCACCTGAACAAGTCTGATCTAGAAAAGCTGGTTGCAAAGTCTTTATTC
GGCGGTAGGAAATTGTATCTTCAAATCTCAATTTACACCGGCAGGCGAGGGTCGACATGTGGTGTGAACTCCGGGAGGTTGCTAGGGAAG
GTTGATGTACCGTTGGATCTGGCGGGAACGGAATCTAGGTCAGTATTGTTTTACAATGGCTGGATTGTGATAGGAAAGGAAGCAAAGAAC
TCGAGTGCTCAGTTTCATTTGAGTGTTAAGGCGGAACCCGACCCGAGATTCGTGTTTCAGTTCGACGGAGAACCGGAATGCAGTCCTCAA
GTATTTCAAATTCAAGGAAACATCCGTCAACCTGTTTTCACATGCAAATTCAGTTTCCGTACCCCCGGCGACCGTAATCAGAGGTCCAGG
TCTTTGCCATTGGAGCATAGTAGTTCACGAGGATGGTTAAGTTCGTTCGGAAGCGAAAGGGAGCGACCAGGGAAGGAGCGAAAGGGATGG
TCAATTACAGTCCACGATCTCTCCGGTTCACCAGTCGCCGCTGCGTCAATGGTTACACCTTTTGTAGCCTCACCCGGTTCTGACCGGGTA
AGCCGGTCCAACCCCGGCTCATGGCTAGTTCTCCGGCCAGGTGACGGAACATGGAAACCATGGGGTAGACTCGAGGCGTGGCGCGAACGT
GGTTCAGCAGACGGGCTTGGCTACCGGTTCGAGCTAATCCCAGACTCAGCGGCAGCTGGAATAGTGTTAGCCGAGTCGACATTAAGCTGT
AGCAAAGGTGGAAAATTCGTGATAGACCTTGGAACGAGCGTGTCAACGAATGGGAAATCAACACCTGTGAACTCGACGTCACCGGCGTGT
AGCCCTAGAGGAAGCGGTGACTTTGGATACGGATTATGGCCTTATTGTATGTATCGAGGTTTTGTGATGTCGGCTAACGTGGAAGGTGAA
GGTGGAAGTAAGTGTAGTAAACCTACAGTGGAAGTTAGCGTACAACACGTGAACTGCACGGAAGACGCAGCGGCATTCGTGGCTTTGTCA
GCTGCCATTGATCTCAGCATTGATGCTTGCAGGCTTTTCTCTCAAAAGCTTAGGAAAGAATTGTGTCCTTCTCAGGATTTGCTCTCCTGA
Edits in Original Sequence 
TTACNGCCGGGGANTTTATTTTTTTGTTATTTTATTTTAGTTTTATGGTTTTACATTAACCAAAAAGGAGTTTATTAGAGTCGTCTTCTT
CCTAAAG
(5')ATGAACACAATATTTTTAAGTGGAGCCAATTCTGXTACACAAATCCCTATGGACTCTATTTCAACTTCTTCTCAACAAC
GGCGCATAATAGAGTTTTTCTTTGTCCTAcGCTTCGCTTATTAGTTCTTCAAATTTGCCTTTAGCTTTACACAACTCGGCGAAACTAAGT
gTGGGCACTAATTAGAATGGATCCATGTCCTTTCGTGAGGCTCAGTGTGTGTAATTTAGCGTTAAAAATTCCGATAGCTTCGAAGCCGGC
TCGTTCCGTTGTGCATCCGTCGTCGTCGCCGTGTTTTTGTAAAATCAAGTTGAAGAATTTTCCTCTCCAGACGGCGGTTGTGCCGTGCAT
TTTGCCGGAGAGTCAGTTTCCCGACGGTCAGGTACAAAGTCATGCGGCGAGTTTTCACCTGAACAAGTCTGATCTAGAAAAGCTGGTTGC
AAAGTCTTTATTCGGCGGTAGGAAATTGTATCTTCAAATCTCAATTTACACCGGCAGGCGAGGGTCGACATGTGGTGTGAACTCCGGGAG
GTTGCTAGGGAAGGTTGATGTACCGTTGGATCTGGCGGGAACGGAATCTAGGTCAGTATTGTTTTACAATGGCTGGATTGTGATAGGAAA
GGAAGCAAAGAACTCGAGTGCTCAGTTTCATTTGAGTGTTAAGGCGGAACCCGACCCGAGATTCGTGTTTCAGTTCGACGGAGAACCGGA
ATGCAGTCCTCAAGTATTTCAAATTCAAGGAAACATCCGTCAACCTGTTTTCACATGCAAATTCAGTTTCCGTACCCCCGGCGACCGTAA
TCAGAGGTCCAGGTCTTTGCCATTGGAGCATAGTAGTTCACGAGGATGGTTAAGTTCGTTCGGAAGCGAAAGGGAGCGACCAGGGAAGGA
GCGAAAGGGATGGTCAATTACAGTCCACGATCTCTCCGGTTCACCAGTCGCCGCTGCGTCAATGGTTACACCTTTTGTAGCCTCACCCGG
TTCTGACCGGGTAAGCCGGTCCAACCCCGGCTCATGGCTAGTTCTCCGGCCAGGTGACGGAACATGGAAACCATGGGGTAGACTCGAGGC
GTGGCGCGAACGTGGTTCAGCAGACGGGCTTGGCTACCGGTTCGAGCTAATCCCAGACTCAGCGGCAGCTGGAATAGTGTTAGCCGAGTC
GACATTAAGCTGTAGCAAAGGTGGAAAATTCGTGATAGACCTTGGAACGAGCGTGTCAACGAATGGGAAATCAACACCTGTGAACTCGAC
GTCACCGGCGTGTAGCCCTAGAGGAAGCGGTGACTTTGGATACGGATTATGGCCTTATTGTATGTATCGAGGTTTTGTGATGTCGGCTAA
CGTGGAAGGTGAAGGTGGAAGTAAGTGTAGTAAACCTACAGTGGAAGTTAGCGTACAACACGTGAACTGCACGGAAGACGCAGCGGCATT
CGTGGCTTTGTCAGCTGCCATTGATCTCAGCATTGATGCTTGCAGGCTTTTCTCTCAAAAGCTTAGGAAAGAATTGTGTCCTTCTCAGGA
TTTGCTCTCCTGA(3')GATTCTTTTTTTAACTGTTTTTTTTTTTACTTGTGAGTGGTAAATGGTGGCGATGAGTTTTAGATATCGTCGG
TCACTAGTTGATTGTTAGTTTTACTAACGAACATTATTAGCCTTTTTTCCTTCAATATGTACAGAGATTGTGGGGGATTTGACTGACAGA
GCACTTTTTTTTGCCTTAAATTGGTGTGTTGCTCATTGTAAACTTTAATCACCCCTATTGCAAGTTGTCAATGTC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan