ESTScan Details for Unigene SGN-U574357

Score 
1659
Direction 
Forward
Predicted Peptide Sequence 
MPRIFNFFLIFFTIVICFTADNIEAQTGQLPRDEVEALREIADQLGKKDWDFKLNPCDGNSNWSTPKRKDMPWYTNMLECNCTFLDNLCH
VENISLIGQDLAGVLPASLAKLPYLRKIDLNRNYLNGTIPPEWASTKLEIMAISNNRLSGHVPEYIGNMTSLVRLSLETNLFNGSLPAEX
RESGQFKDAXEWPVELNNLTKLDELRITSNSFVGKLPNFESWKNLRKLEIEGSGFEGPLPPSFSVLSSLEELRISDLNGGASEFPSLTNL
TSMTKLVLRSCNIHGNIHDSVAEMVNLRFLDLSFNNLEGGIANLEHVTQMEATYLTGNAFVGQIPNWLTSRDTRNVIDLSYNKFDESSEP
GSCRDNLNLFRSFKVENFVERGKCFSASPCSEDKYSLHINCGGGNVTVGNTTYIADEDSAGAAKFVYWKGNWGTSSTGHFWDTDVSLDDH
KAKNVSAIKGDESQLYMTAHLSPLAMTYFGRCLANGNYTLTLHFAEIVYRDNQSFRSLGKRIYDIYIQDKLKFKDFDIKRLAGGVDKALK
EKFNVTVKDKSVQVRFQYAGKGTTSIPSRGHYGPLVSAISLEANFKPPPPQETSSNQKKKILIVAGAVTSSLALVLMIFFVAWKKRRNRK
LMEQELRGLDLQTGIFTFRQIKAATSNFDSANKLGEGGFGSVYKVFIYTNSHNSSFPSLWKFYWIFQTNYALHEFXFDAQGTLADGTIIA
VKQLSSKSRQGNREFVNEIGMMSGLHHPNLSDSTDVVLSGTNFY*
Predicted Coding Sequence 
ATGCCAAGAATCTTCAATTTCTTTCTCATCTTCTTCACCATAGTTATTTGCTTTACTGCAGACAACATTGAAGCACAAACTGGTCAACTT
CCTAGAGATGAAGTGGAAGCTCTTAGAGAAATAGCTGATCAATTGGGGAAAAAAGATTGGGATTTTAAGCTAAACCCTTGTGATGGGAAC
TCAAATTGGAGTACACCCAAAAGGAAAGATATGCCTTGGTATACAAATATGCTAGAATGCAACTGCACTTTTCTTGATAATCTTTGTCAT
GTGGAAAATATATCTCTCATAGGGCAGGATCTTGCAGGTGTCCTACCTGCATCTCTGGCGAAGTTACCATACCTGAGGAAAATTGATCTC
AACCGCAACTACTTAAATGGTACAATTCCCCCTGAATGGGCGTCTACCAAGTTGGAGATCATGGCTATTTCTAATAATCGGTTATCTGGG
CATGTCCCTGAGTACATAGGAAATATGACCTCGCTTGTGAGATTGAGTTTGGAGACTAACTTGTTTAATGGATCGTTACCAGCAGAAGXT
AGGGAATCTGGTCAATTTAAAGATGCTGAXGAGTGGCCAGTGGAACTGAATAATCTTACTAAATTGGATGAACTTAGGATAACCAGTAAC
AGCTTTGTTGGGAAACTGCCTAACTTTGAGAGTTGGAAAAACCTCCGGAAGCTAGAAATTGAAGGTTCTGGATTTGAAGGACCACTACCC
CCAAGTTTTTCTGTTTTGAGCAGTTTGGAAGAACTAAGAATCAGTGACCTCAACGGAGGTGCTTCAGAATTTCCATCACTTACAAACTTG
ACGAGTATGACTAAATTGGTTTTGAGAAGCTGTAATATACATGGAAATATTCATGATTCTGTAGCTGAAATGGTCAACTTACGGTTTTTA
GATCTAAGTTTCAACAATCTTGAAGGAGGAATTGCAAATCTCGAGCACGTGACTCAGATGGAGGCCACGTATCTGACTGGCAATGCTTTT
GTTGGACAAATTCCAAATTGGCTTACTAGTCGAGATACCAGAAATGTGATAGACCTTTCCTACAATAAATTTGATGAAAGCTCTGAACCA
GGTTCCTGTCGGGACAACCTAAACTTATTCAGAAGCTTCAAGGTCGAGAATTTTGTAGAGCGCGGGAAGTGCTTCTCAGCCAGTCCGTGT
TCAGAGGACAAGTACTCATTGCACATAAATTGTGGTGGAGGAAACGTAACTGTTGGAAACACTACTTATATAGCAGATGAAGACTCCGCA
GGTGCTGCAAAATTTGTTTACTGGAAAGGGAACTGGGGAACCAGCAGTACAGGGCATTTCTGGGATACCGACGTATCGTTGGATGACCAC
AAAGCAAAAAATGTATCTGCTATCAAGGGAGATGAATCTCAACTTTACATGACAGCTCACCTCTCCCCTTTAGCTATGACTTACTTTGGA
CGTTGCTTAGCAAATGGAAACTACACTTTGACACTTCATTTTGCAGAAATAGTTTACAGAGACAACCAATCTTTCCGAAGTCTTGGAAAA
CGGATATATGATATATACATACAGGACAAATTGAAGTTCAAAGATTTTGATATTAAAAGACTAGCCGGAGGAGTTGATAAAGCTTTGAAA
GAAAAGTTTAATGTAACAGTAAAAGATAAATCTGTACAAGTGCGCTTCCAATATGCTGGGAAAGGAACTACATCAATCCCGAGCAGAGGA
CACTATGGTCCTTTAGTATCTGCCATCTCTCTGGAAGCTAACTTCAAGCCCCCTCCTCCGCAGGAGACCTCTTCTAATCAGAAAAAGAAG
ATCCTAATTGTAGCTGGAGCAGTGACGTCTTCTTTAGCTCTCGTTCTGATGATTTTCTTTGTTGCTTGGAAGAAAAGAAGAAACAGGAAA
TTGATGGAACAAGAATTAAGAGGACTAGATCTGCAAACTGGTATATTTACTTTCAGACAAATTAAAGCTGCCACAAGTAACTTTGATTCT
GCAAATAAGCTTGGTGAAGGTGGATTTGGATCTGTCTACAAGGTGTTCATATATACAAATTCTCATAATTCTTCTTTTCCCTCTCTGTGG
AAATTCTACTGGATATTTCAGACAAATTATGCTCTTCATGAATTTTTXTTTGATGCTCAGGGTACTCTAGCAGATGGTACTATAATTGCT
GTCAAGCAGCTTTCATCCAAGTCAAGACAAGGGAACCGTGAATTTGTGAATGAAATAGGCATGATGTCAGGCTTACATCACCCAAATCTC
TCCGACTCTACGGATGTTGTGTTGAGCGGAACCAACTTTTACTAG
Edits in Original Sequence 
ACAAGAAAAGAGCATTTTCATTTTAAATTCTCCTTCTCATGCAATTATGTACACAAGATTTTGGGTCATAAGAACCATAAACAAACAAGC
TATTTTATAGTGATATAGAATATATATAGTACTTATATAGAAAAGGTTCATCATTTGCTCCCACAAGTTCAAATTCTTTTTCAGCAACTT
GTCTTCTTCTCCTTAAATCTATTATCTCCATTTTTTTAAAACAATTTTTTCCTCAGAGCAGCTTCATTTTCTCAGAAAAAGACCCAAAAA
AATCACTGAAATTTTCATATGAGTAGTACTCAAGCTTTTGAAGTTTAAGGGACC
(5')ATGCCAAGAATCTTCAATTTCTTTCTCATCTT
CTTCACCATAGTTATTTGCTTTACTGCAGACAACATTGAAGCACAAACTGGTCAACTTCCTAGAGATGAAGTGGAAGCTCTTAGAGAAAT
AGCTGATCAATTGGGGAAAAAAGATTGGGATTTTAAGCTAAACCCTTGTGATGGGAACTCAAATTGGAGTACACCCAAAAGGAAAGATAT
GCCTTGGTATACAAATATGCTAGAATGCAACTGCACTTTTCTTGATAATCTTTGTCATGTGGAAAATATATCTCTCATAGGGCAGGATCT
TGCAGGTGTCCTACCTGCATCTCTGGCGAAGTTACCATACCTGAGGAAAATTGATCTCAACCGCAACTACTTAAATGGTACAATTCCCCC
TGAATGGGCGTCTACCAAGTTGGAGATCATGGCTATTTCTAATAATCGGTTATCTGGGCATGTCCCTGAGTACATAGGAAATATGACCTC
GCTTGTGAGATTGAGTTTGGAGACTAACTTGTTTAATGGATCGTTACCAGCAGAAGXTAGGGAATCTGGTCAATTTAAAGATGCTGAXGA
GTGGCCAGTGGAACTGAATAATCTTACTAAATTGGATGAACTTAGGATAACCAGTAACAGCTTTGTTGGGAAACTGCCTAACTTTGAGAG
TTGGAAAAACCTCCGGAAGCTAGAAATTGAAGGTTCTGGATTTGAAGGACCACTACCCCCAAGTTTTTCTGTTTTGAGCAGTTTGGAAGA
ACTAAGAATCAGTGACCTCAACGGAGGTGCTTCAGAATTTCCATCACTTACAAACTTGACGAGTATGACTAAATTGGTTTTGAGAAGCTG
TAATATACATGGAAATATTCATGATTCTGTAGCTGAAATGGTCAACTTACGGTTTTTAGATCTAAGTTTCAACAATCTTGAAGGAGGAAT
TGCAAATCTCGAGCACGTGACTCAGATGGAGGCCACGTATCTGACTGGCAATGCTTTTGTTGGACAAATTCCAAATTGGCTTACTAGTCG
AGATACCAGAAATGTGATAGACCTTTCCTACAATAAATTTGATGAAAGCTCTGAACCAGGTTCCTGTCGGGACAACCTAAACTTATTCAG
AAGCTTCAAGGTCGAGAATTTTGTAGAGCGCGGGAAGTGCTTCTCAGCCAGTCCGTGTTCAGAGGACAAGTACTCATTGCACATAAATTG
TGGTGGAGGAAACGTAACTGTTGGAAACACTACTTATATAGCAGATGAAGACTCCGCAGGTGCTGCAAAATTTGTTTACTGGAAAGGGAA
CTGGGGAACCAGCAGTACAGGGCATTTCTGGGATACCGACGTATCGTTGGATGACCACAAAGCAAAAAATGTATCTGCTATCAAGGGAGA
TGAATCTCAACTTTACATGACAGCTCACCTCTCCCCTTTAGCTATGACTTACTTTGGACGTTGCTTAGCAAATGGAAACTACACTTTGAC
ACTTCATTTTGCAGAAATAGTTTACAGAGACAACCAATCTTTCCGAAGTCTTGGAAAACGGATATATGATATATACATACAGGACAAATT
GAAGTTCAAAGATTTTGATATTAAAAGACTAGCCGGAGGAGTTGATAAAGCTTTGAAAGAAAAGTTTAATGTAACAGTAAAAGATAAATC
TGTACAAGTGCGCTTCCAATATGCTGGGAAAGGAACTACATCAATCCCGAGCAGAGGACACTATGGTCCTTTAGTATCTGCCATCTCTCT
GGAAGCTAACTTCAAGCCCCCTCCTCCGCAGGAGACCTCTTCTAATCAGAAAAAGAAGATCCTAATTGTAGCTGGAGCAGTGACGTCTTC
TTTAGCTCTCGTTCTGATGATTTTCTTTGTTGCTTGGAAGAAAAGAAGAAACAGGAAATTGATGGAACAAGAATTAAGAGGACTAGATCT
GCAAACTGGTATATTTACTTTCAGACAAATTAAAGCTGCCACAAGTAACTTTGATTCTGCAAATAAGCTTGGTGAAGGTGGATTTGGATC
TGTCTACAAGGTGTTCATATATACAAATTCTCATAATTCTTCTTTTCCCTCTCTGTGGAAATTCTACTGGATATTTCAGACAAATTATGC
TCTTCATGAATTTTTXTTTGATGCTCAGGGTACTCTAGCAGATGGTACTATAATTGCTGTCAAGCAGCTTTCATCCAAGTCAAGACAAGG
GAACCGTGAATTTGTGAATGAAATAGGCATGATGTCAGGCTTACATCACCCAAATCTCgTCCGACTCTACGGATGTTGTGTTGAGCGGAA
CCAACTTTTACTAG(3')TTTATGAGTACATGGAGAACAATAACCTTTCCCATGTTTTGTTTGGTAATGTTATTTTTTCATACTTGATTT
TGATATATTTTACTTGAGCTCTCTACCTTCAC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan