ESTScan Details for Unigene SGN-U574490

Score 
1044
Direction 
Forward
Predicted Peptide Sequence 
MSGSKLEGPSAPVVRRDPYEVLAVTRDSSDQEIKTAYRKLALKYHPDKNANNPEASEHFKEVAYSYSILSDPEKRRQYDMAGFEALEAEG
MDMEIDLSNLGTVNTMFAALFSKLGVPIKTTISANVLEEALNGTVTVRPLPIGTSVSGKVEKQNAHFFGVTISDEQAEAGIVVRATSAAQ
SKFKLLYFEHDVSGGYGLALQEDSEKAGKVTSAGMYFLHFQVYRMDSTVNALAMAKDPEAAFFKRLEGLQPCEVSQLNAGTHIFAVYGLS
CFYFVEYMFFIFLKDXYLIATDYANTKEMFDLISAGDNFFKPASYTIEALCAKTYEDTTHNLQDIEAQILRKRNELRQFETEYRKALARF
QEVTNRYSQEKQSVEELLKQRDTIHSSFTVTRTIATLSGSGSGHFSNGSSSKPSGDDSKPDSPGDDSSSDSKDKYAKRKWFNLNLKGSEK
K*
Predicted Coding Sequence 
ATGAGTGGTTCAAAATTGGAGGGGCCATCGGCTCCGGTGGTAAGACGAGACCCGTATGAAGTGTTGGCTGTGACGAGGGATTCGTCGGAT
CAGGAGATTAAGACTGCTTATAGAAAGCTTGCTCTCAAGTATCATCCTGACAAGAATGCTAACAATCCTGAAGCTTCAGAACATTTCAAG
GAGGTTGCATACTCATATAGCATTCTATCTGATCCAGAGAAAAGGAGGCAATATGATATGGCTGGCTTTGAGGCTCTTGAAGCTGAAGGA
ATGGATATGGAAATTGATTTGTCCAACCTTGGAACTGTCAACACAATGTTTGCAGCATTGTTTAGCAAGTTGGGTGTTCCTATCAAAACA
ACTATCTCTGCGAATGTTCTTGAAGAAGCTTTGAATGGAACTGTCACGGTCCGCCCTCTTCCAATTGGTACATCAGTCAGTGGAAAGGTA
GAAAAGCAAAATGCTCATTTTTTCGGTGTAACAATTAGTGACGAACAAGCAGAAGCAGGGATTGTAGTAAGAGCTACTTCAGCTGCCCAA
AGCAAATTCAAGCTACTATATTTTGAACATGATGTGAGTGGGGGTTACGGCCTGGCCTTGCAGGAAGATAGTGAAAAAGCAGGCAAGGTA
ACCTCCGCAGGGATGTATTTCTTGCACTTTCAAGTGTACAGAATGGATTCAACTGTAAATGCGTTAGCAATGGCCAAAGATCCTGAAGCT
GCTTTCTTTAAGAGGCTGGAGGGCCTTCAACCTTGTGAGGTCTCACAACTAAATGCTGGCACTCACATATTTGCTGTTTATGGTCTGAGC
TGCTTTTATTTTGTTGAATATATGTTTTTTATATTTTTGAAAGATXACTATCTGATTGCTACTGATTACGCAAACACTAAAGAAATGTTT
GATTTAATTTCTGCAGGAGATAATTTTTTTAAGCCTGCTAGTTATACTATTGAGGCTCTGTGTGCCAAGACATACGAGGACACAACTCAT
AATCTCCAGGATATCGAGGCTCAAATATTGAGGAAGAGAAATGAGCTTCGACAGTTTGAAACAGAATATAGAAAGGCATTAGCGCGGTTC
CAGGAAGTGACCAATAGATATAGCCAGGAGAAGCAGTCTGTCGAAGAACTGCTCAAACAGAGAGACACCATACACTCTTCTTTCACCGTT
ACAAGGACAATTGCTACGTTAAGTGGCAGTGGGAGTGGCCATTTCAGTAACGGAAGTAGCAGTAAACCTTCTGGTGATGACTCAAAACCC
GATAGCCCAGGGGACGATAGCAGTTCAGACTCCAAGGACAAATACGCGAAGAGAAAATGGTTCAACCTTAACCTCAAAGGATCCGAGAAG
AAGTAA
Edits in Original Sequence 
CAAAAAAGCTCCAGCTGAAAGAAAAAAAATTTGTTCATTCTTTTTCTGGATTTTGGGAAATCAAGGTTTTTTTTTTGTGTTCTATTGATT
TTTGCGGTGGAAAAAGGGTGTA
(5')ATGAGTGGTTCAAAATTGGAGGGGCCATCGGCTCCGGTGGTAAGACGAGACCCGTATGAAGTGT
TGGCTGTGACGAGGGATTCGTCGGATCAGGAGATTAAGACTGCTTATAGAAAGCTTGCTCTCAAGTATCATCCTGACAAGAATGCTAACA
ATCCTGAAGCTTCAGAACATTTCAAGGAGGTTGCATACTCATATAGCATTCTATCTGATCCAGAGAAAAGGAGGCAATATGATATGGCTG
GCTTTGAGGCTCTTGAAGCTGAAGGAATGGATATGGAAATTGATTTGTCCAACCTTGGAACTGTCAACACAATGTTTGCAGCATTGTTTA
GCAAGTTGGGTGTTCCTATCAAAACAACTATCTCTGCGAATGTTCTTGAAGAAGCTTTGAATGGAACTGTCACGGTCCGCCCTCTTCCAA
TTGGTACATCAGTCAGTGGAAAGGTAGAAAAGCAAAATGCTCATTTTTTCGGTGTAACAATTAGTGACGAACAAGCAGAAGCAGGGATTG
TAGTAAGAGCTACTTCAGCTGCCCAAAGCAAATTCAAGCTACTATATTTTGAACATGATGTGAGTGGGGGTTACGGCCTGGCCTTGCAGG
AAGATAGTGAAAAAGCAGGCAAGGTAACCTCCGCAGGGATGTATTTCTTGCACTTTCAAGTGTACAGAATGGATTCAACTGTAAATGCGT
TAGCAATGGCCAAAGATCCTGAAGCTGCTTTCTTTAAGAGGCTGGAGGGCCTTCAACCTTGTGAGGTCTCACAACTAAATGCTGGCACTC
ACATATTTGCTGTTTATGGTCTGAGCTGCTTTTATTTTGTTGAATATATGTTTTTTATATTTTTGAAAGATXACTATCTGATTGCTACTG
ATTACGCAAACACTAAAGAAATGTTTGATTTAATTTCTGCAGGAGATAATTTTTTTAAGCCTGCTAGTTATACTATTGAGGCTCTGTGTG
CCAAGACATACGAGGACACAACTCATAATCTCCAGGATATCGAGGCTCAAATATTGAGGAAGAGAAATGAGCTTCGACAGTTTGAAACAG
AATATAGAAAGGCATTAGCGCGGTTCCAGGAAGTGACCAATAGATATAGCCAGGAGAAGCAGTCTGTCGAAGAACTGCTCAAACAGAGAG
ACACCATACACTCTTCTTTCACCGTTACAAGGACAATTGCTACGTTAAGTGGCAGTGGGAGTGGCCATTTCAGTAACGGAAGTAGCAGTA
AACCTTCTGGTGATGACTCAAAACCCGATAGCCCAGGGGACGATAGCAGTTCAGACTCCAAGGACAAATACGCGAAGAGAAAATGGTTCA
ACCTTAACCTCAAAGGATCCGAGAAGAAGTAA(3')TCAGACTGAAGAATTCTCCAAATGTACTATTTGTTCTATTTTCTTGGGCTTCCG
AGACGTTCATTAATTTTTTTCGAAATATCATTTTTTGGGCACGTTGATATGTCTATTTTCTATCGATTGATCGAAGATATAGAAGGGTTT
TTTTTTGTTCCTGTATTGTACGTATGATTCTTCTGCGGTGTATCATAATGTACTTAGTCAATGTATTTCATTATTTTC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan