ESTScan Details for Unigene SGN-U574515

Score 
567
Direction 
Forward
Predicted Peptide Sequence 
MKITALMVLKCNPEGSDPVILANASDVNHFGYFQRSSVKEFIVFVGRTVAKRNPPGQRQSVQHEEYKVHSYNRNGLCALGFMDDHYPVRS
AFSLLNQVLDEYLKNFGESWKTAQCDNAQPWPYLNEALAKFQDPAEADKLFKIQRELDETKIILHKTIDSVLERGEKLDSLVEKSSDLSA
ASQMFYKQAKKTNSCCTIL*
Predicted Coding Sequence 
ATGAAGATCACAGCTTTGATGGTGTTGAAATGCAATCCAGAAGGTTCGGATCCTGTGATCTTAGCAAACGCTTCTGATGTTAACCATTTT
GGGTATTTTCAGAGATCCAGCGTTAAGGAATTTATCGTTTTTGTGGGTCGAACTGTTGCTAAAAGGAACCCACCTGGACAACGACAATCT
GTTCAGCATGAAGAATACAAGGTGCATTCATACAATCGAAATGGTTTATGTGCTTTGGGCTTCATGGATGATCACTATCCAGTTCGAAGT
GCATTTTCACTGCTCAACCAGGTTTTGGATGAGTATCTGAAGAATTTTGGTGAGTCATGGAAGACGGCTCAATGCGACAATGCTCAACCA
TGGCCTTATCTGAATGAAGCTCTAGCCAAATTTCAGGATCCTGCTGAGGCCGATAAGCTGTTCAAAATTCAACGAGAGTTGGATGAAACA
AAAATTATTCTCCATAAGACAATTGACAGTGTCTTAGAACGTGGTGAGAAGCTAGACAGTTTGGTTGAGAAGAGTTCAGATCTCAGTGCT
GCTTCACAGATGTTCTACAAGCAGGCAAAGAAAACCAATTCATGCTGTACAATTTTATAG
Edits in Original Sequence 
TCTCTCTCTCTCTTTTTTTTCCTTTTTCTTATTCTTATTCCTTCTCCATTAAATAATGAATAGCAATAAAATAAAATAAAATAAATAGTA
ATAAAATTCAACACATCGCGTAATCTGAAGAAGAATCAGTTCTATTCCTTCGAAGGCGGCCATAGAAGAGAGGAAAAAAAAAATTCTTTG
AAATTTATTTTGGTGTTTTTGGATAATTTTTTGAAGAAGTTTGAGAGGTTTAGAGAGAAAAACAGAG
(5')ATGAAGATCACAGCTTTGA
TGGTGTTGAAATGCAATCCAGAAGGTTCGGATCCTGTGATCTTAGCAAACGCTTCTGATGTTAACCATTTTGGGTATTTTCAGAGATCCA
GCGTTAAGGAATTTATCGTTTTTGTGGGTCGAACTGTTGCTAAAAGGAACCCACCTGGACAACGACAATCTGTTCAGCATGAAGAATACA
AGGTGCATTCATACAATCGAAATGGTTTATGTGCTTTGGGCTTCATGGATGATCACTATCCAGTTCGAAGTGCATTTTCACTGCTCAACC
AGGTTTTGGATGAGTATCTGAAGAATTTTGGTGAGTCATGGAAGACGGCTCAATGCGACAATGCTCAACCATGGCCTTATCTGAATGAAG
CTCTAGCCAAATTTCAGGATCCTGCTGAGGCCGATAAGCTGTTCAAAATTCAACGAGAGTTGGATGAAACAAAAATTATTCTCCATAAGA
CAATTGACAGTGTCTTAGAACGTGGTGAGAAGCTAGACAGTTTGGTTGAGAAGAGTTCAGATCTCAGTGCTGCTTCACAGATGTTCTACA
AGCAGGCAAAGAAAACCAATTCATGCTGTACAATTTTATAG(3')ACTGTTTTCTGAAGATGGAAGGGGGCGATTCAACCACGGATAAAC
TTGTGTCTATGTTGCATATGAAGTATCGGAGAATTGTTTGTTTATATCATCCATGATATTCTATAAGCTTGAATTCTTTTTGTTCTCTAT
TGTAATATGATCTCAGATGAAGAGAAAAAGTCAGTCTCAGATTGATAGATCTTGTTTGAAAGTTGTGATGTGATGATGTTCACCTAAATG
TAGTTACAATATAACATATTTCCTGTTTCGAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan