ESTScan Details for Unigene SGN-U574596

Score 
744
Direction 
Forward
Predicted Peptide Sequence 
XXXXXYGRGFIFPSIFSGYIFVPQALRSENGKRSTSLVVSTNXPAPVPPFLEDHHRQFPILTGDSERWMFPAITLVSKXRDVSYRPPGTK
IDLLSQVNLSIPEKSFGLIFGRSGSGKTTLLQLIAGLSKPTSGSIYVQRYGDDDQQIKSPEPLQPERVGIVFQFPERYFVADTVLDEVTF
GWPRQKGGLQLRELLASRLQKAIMSVGLTGISLDKDPHSLSGGYKRRLALAIQLVQTPDLLILDEPLAGLDWKARADVAKLLKDLKKELT
LLVVSHDLKELASLVDQSWRMEMGGALKKEPLPI*
Predicted Coding Sequence 
CNNNNNNNNNNNNNTTACGGCCGGGGGTTCATCTTCCCCTCAATTTTCTCTGGTTACATTTTTGTTCCGCAGGCTCTGAGATCAGAAAAT
GGGAAGCGTTCCACTTCCCTCGTCGTCTCTACTAATXTTCCAGCTCCAGTTCCTCCATTTTTGGAAGATCATCATCGACAATTTCCTATC
CTCACCGGCGATTCAGAAAGGTGGATGTTTCCTGCGATTACTCTTGTTTCGAAAXTAAGGGATGTCTCTTATCGACCTCCAGGAACCAAG
ATCGATCTACTGAGTCAAGTCAACCTTTCCATCCCTGAGAAAAGTTTTGGCTTGATATTTGGACGGAGTGGCAGTGGAAAAACTACTTTA
TTGCAGCTGATTGCAGGGTTAAGCAAACCAACATCAGGTTCAATATATGTGCAAAGATATGGTGATGATGATCAACAGATTAAGTCTCCT
GAACCCTTACAACCTGAAAGAGTTGGCATTGTTTTCCAATTTCCTGAGAGATACTTTGTTGCGGACACTGTTCTTGATGAAGTTACATTT
GGGTGGCCAAGACAAAAGGGTGGCCTACAATTAAGAGAGCTTCTTGCTTCTAGACTTCAAAAGGCCATTATGTCGGTTGGTCTAACAGGA
ATATCTTTGGATAAGGATCCCCATTCATTAAGCGGTGGTTACAAACGTCGGCTAGCCCTTGCTATTCAGTTAGTTCAAACACCAGATTTA
TTAATATTGGATGAGCCTCTTGCTGGTCTTGATTGGAAGGCTCGTGCAGATGTGGCAAAATTGTTAAAAGATCTGAAGAAGGAGCTAACT
TTACTTGTTGTCAGCCATGACCTCAAGGAGTTGGCATCTTTGGTAGATCAATCTTGGAGGATGGAAATGGGAGGAGCACTTAAAAAAGAG
CCTCTACCCATTTAA
Edits in Original Sequence 
(5')CNNNNNNNNNNNNNTTACGGCCGGGGGTTCATCTTCCCCTCAATTTTCTCTGGTTACATTTTTGTTCCGCAGGCTCTGAGATCAGA
AAATGGGAAGCGTTCCACTTCCCTCGTCGTCTCTACTAATXTTCCAGCTCCAGTTCCTCCATTTTTGGAAGATCATCATCGACAATTTCC
TATCCTCACCGGCGATTCAGAAAGGTGGATGTTTCCTGCGATTACTCTTGTTTCGAAAXTAAGGGATGTCTCTTATCGACCTCCAGGAAC
CAAGATCGATCTACTGAGTCAAGTCAACCTTTCCATCCCTGAGAAAAGTTTTGGCTTGATATTTGGACGGAGTGGCAGTGGAAAAACTAC
TTTATTGCAGCTGATTGCAGGGTTAAGCAAACCAACATCAGGTTCAATATATGTGCAAAGATATGGTGATGATGATCAACAGATTAAGTC
TCCTGAACCCTTACAACCTGAAAGAGTTGGCATTGTTTTCCAATTTCCTGAGAGATACTTTGTTGCGGACACTGTTCTTGATGAAGTTAC
ATTTGGGTGGCCAAGACAAAAGGGTGGCCTACAATTAAGAGAGCTTCTTGCTTCTAGACTTCAAAAGGCCATTATGTCGGTTGGTCTAAC
AGGAATATCTTTGGATAAGGATCCCCATTCATTAAGCGGTGGTTACAAACGTCGGCTAGCCCTTGCTATTCAGTTAGTTCAAACACCAGA
TTTATTAATATTGGATGAGCCTCTTGCTGGTCTTGATTGGAAGGCTCGTGCAGATGTGGCAAAATTGTTAAAAGATCTGAAGAAGGAGCT
AACTTTACTTGTTGTCAGCCATGACCTCAAGGAGTTGGCATCTTTGGTAGATCAATCTTGGAGGATGGAAATGGGAGGAGCACTTAAAAA
AGAGCCTCTACCCATTTAA(3')TGCACTGAACTTATAATGTTCCCAACAATCATTTTCTGATGTAATATATGAGGTTTTTATGAGCCTT
GAATTGCATACAATTCTTGGAGAGGTGCTCAAGGTTATTGATTTTGCTTCAATCCCTGACCATCGAGGTCTTCACATTTCATGTAACCTC
TGTAATGTAATTAACAGTTTCTGTAATGAGTTTTGAGATGGTTTCTAATTTTCTGTACACTTAGTTCGCCGTTTAAACTCTCATTAAAGT
TTGATGGGTCTGCAGCATTTCTTTGTCCTTGTCTCTCACCAAAAGTTTTGAATGTTGATTGGAATTTTGTTCAAAATATGTATAGTAGTA
TGCATGTATTGGTAAATTAAATTACACTGTTGACATATATGAATAGTAGCTTTTCTAGTTGTGTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan