ESTScan Details for Unigene SGN-U574683

Score 
439
Direction 
Forward
Predicted Peptide Sequence 
TAAAAFLTFMDPRAAGISAEGAMHVKTWGIFQVVNHGISLKYFDEVESQARRLFALPTEQKVKVVRSTNGVTGYGTARITPFFSKFMWHE
GFTIVDSPLDHAKELWPNDYKKFCDVMENYQTKMKVLSFQLCMFILNYLQPSHEHSINSFEFEGALQLNSYPCCPNPYHALGLAPHTDSL
FLTILHQTNNTKGLQILKKDQGWTSIAPVSNDALIVNVGDLLHILSNGEFPSV
Predicted Coding Sequence 
ACCGCGGCGGCGGCTTTTTTAACATTTATGGATCCCCGGGCTGCAGGAATTTCGGCAGAAGGGGCCATGCATGTXAAAACATGGGGAATA
TTTCAAGTTGTTAATCATGGAATTTCTTTAAAATATTTTGATGAAGTTGAATCTCAGGCAAGGCGACTTTTTGCCTTGCCTACTGAACAA
AAGGTGAAGGTCGTAAGATCAACTAATGGTGTCACCGGCTATGGCACAGCTCGAATTACGCCGTTTTTCTCAAAGTTCATGTGGCATGAA
GGGTTCACAATTGTGGATTCACCACTTGATCATGCTAAGGAACTTTGGCCAAATGACTATAAGAAATTTTGTGATGTGATGGAAAATTAT
CAAACGAAGATGAAAGTTCTATCCTTCCAACTCTGCATGTTCATCCTCAACTACTTACAACCATCTCATGAACATTCAATTAATTCATTT
GAATTTGAAGGAGCCCTACAGTTAAATTCATATCCATGTTGTCCTAACCCTTACCACGCACTGGGGTTAGCTCCTCACACAGATTCCTTA
TTCCTAACAATACTCCATCAAACAAATAATACAAAGGGTCTTCAAATCTTGAAAAAAGACCAAGGATGGACTTCAATTGCTCCGGTTTCC
AACGATGCCCTCATTGTTAATGTAGGCGATCTTCTTCATATACTCTCTAATGGTGAATTTCCATCGGTX
Edits in Original Sequence 
(5')ACCGCGGCGGCGGCTTTTTTAACATTTATGGATcCCCCGGGCTGCAGGAATTTCGGCAGAAGGGGCCATGCATGTXAAAACATGGG
GAATATTTCAAGTTGTTAATCATGGAATTTCTTTAAAATATTTTGATGAAGTTGAATCTCAGGCAAGGCGACTTTTTGCCTTGCCTACTG
AACAAAAGGTGAAGGTCGTAAGATCAACTAATGGTGTCACCGGCTATGGCACAGCTCGAATTACGCCGTTTTTCTCAAAGTTCATGTGGC
ATGAAGGGTTCACAATTGTGGATTCACCACTTGATCATGCTAAGGAACTTTGGCCAAATGACTATAAGAAATTTTGTGATGTGATGGAAA
ATTATCAAACGAAGATGAAAGTTCTATCCTTCCAACTCTGCATGTTCATCCTCAACTACTTACAACCATCTCATGAACATTCAATTAATT
CATTTGAATTTGAAGGAGCCCTACAGTTAAATTCATATCCATGTTGTCCTAACCCTTACCACGCACTGGGGTTAGCTCCTCACACAGATT
CCTTATTCCTAACAATACTCCATCAAACAAATAATACAAAGGGTCTTCAAATCTTGAAAAAAGACCAAGGATGGACTTCAATTGCTCCGG
TTTCCAACGATGCCCTCATTGTTAATGTAGGCGATCTTCTTCATATACTCTCTAATGGTGAATTTCCATCGGTX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan