ESTScan Details for Unigene SGN-U574830

Score 
675
Direction 
Forward
Predicted Peptide Sequence 
GRLAAKSASPPLETGLEIKPPGSTRFLWHRFRFPSLPNSAVVLIGISERHGIRLQKPTGPPYDTQSPMYGRPATGAPQPHPMYGQAPGLY
PRPGQHSGGRNPPFHHTPPPSSNTGIGIRVAIKPEYRITPPPQLSNKWEKFPEAXFNFDFDLEKKILAEAEKESQNWSKLGLENLPPIMP
EQPSMGYTGDLMMNKYATAGFNREAVAIAVANYGDNPIKVKEFVEGYTLLKEMGFSSNSVADALLMNDNDKDKAAAQLLGNSS**
Predicted Coding Sequence 
GGGCGATTGGCGGCCAAATCGGCAAGCCCACCTTTAGAGACAGGCTTGGAAATCAAACCTCCGGGTTCAACTAGATTCCTCTGGCACCGG
TTTCGTTTTCCTTCTCTTCCGAATTCTGCTGTTGTTCTGATCGGAATCAGTGAACGCCATGGAATACGACTTCAGAAACCAACAGGACCT
CCTTACGATACACAATCGCCGATGTACGGCAGGCCAGCTACCGGAGCTCCACAGCCACATCCTATGTACGGACAAGCTCCCGGACTCTAT
CCTAGACCTGGTCAACACTCCGGCGGCCGGAACCCTCCTTTCCATCACACGCCTCCTCCGTCTTCAAACACTGGAATCGGCATCAGAGTT
GCTATTAAACCCGAATATCGGATTACACCTCCGCCTCAATTGTCAAACAAGTGGGAGAAATTCCCCGAAGCAXCATTCAACTTTGATTTT
GACCTTGAGAAAAAGATTTTGGCTGAAGCAGAAAAGGAAAGCCAGAACTGGAGCAAGCTAGGGCTGGAAAATCTTCCACCTATAATGCCA
GAACAACCTAGCATGGGATACACTGGAGATCTTATGATGAACAAATACGCAACAGCTGGTTTCAATAGAGAGGCTGTGGCCATAGCAGTT
GCAAATTATGGTGATAATCCGATCAAGGTGAAGGAATTTGTGGAGGGATATACTCTCTTGAAAGAGATGGGATTCTCATCAAACAGTGTT
GCAGATGCCTTACTGATGAATGACAACGATAAAGATAAGGCAGCAGCTCAATTGCTAGGCAATTCATCATAATAA
Edits in Original Sequence 
(5')GGGCGATTGGCGGCCAAATCGGCAAGCCCACCTTTAGAGACAGGCTTGGAAATCAAACCTCCGGGTTCAACTAGATTCCTCTGGCA
CCGGTTTCGTTTTCCTTCTCTTCCGAATTCTGCTGTTGTTCTGATCGGAATCAGTGAACGCCATGGAATACGACTTCAGAAACCgAACAG
GACCTCCTTACGATACACAATCGCCGATGTACGGCAGGCCAGCTACCGGAGCTCCACAGCCACATCCTATGTACGGACAAGCTCCCGGAC
TCTATCCTAGACCTGGTCAACACTCCGGCGGCCGGAACCCTCCTTTCCATCACACGCCTCCTCCGTCTTCAAACACTGGAATCGGCATCA
GAGTTGCTATTAAACCCGAATATCGGATTACACCTCCGCCTCAATTGTCAAcACAAGTGGGAGAAATTCCCCGAAGCAXCATTCAACTTT
GATTTTGACCTTGAGAAAAAGATTTTGGCTGAAGCAGAAAAGGAAAGCCAGAACTGGAGCAAGCTAGGGCTGGAAAATCTTCCACCTATA
ATGCCAGAACAACCTAGCATGGGATACACTGGAGATCTTATGATGAACAAATACGCAACAGCTGGTTTCAATAGAGAGGCTGTGGCCATA
GCAGTTGCAAATTATGGTGATAATCCGATCAAGGTGAAGGAATTTGTGGAGGGATATACTCTCTTGAAAGAGATGGGATTCTCATCAAAC
AGTGTTGCAGATGCCTTACTGATGAATGACAACGATAAAGATAAGGCAGCAGCTCAATTGCTAGGCAATTCATCATAATAA(3')TTTTA
ATGAATATGTAACGTAATGAATGTGTCACTACATTATAATTCAAACCTTATACTTCCATTGTAAATGTATGTTTTACCCATTTACGTGTG
TGCTGATGAGATATTTTCTGGTGACTCCTATTATTAGCTTTTATATAACTGATGTCTGGCTGGTAGCGATTATTATT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan