ESTScan Details for Unigene SGN-U574843

Score 
346
Direction 
Forward
Predicted Peptide Sequence 
MADKVQRMSSEHGGDDFQQEYVLFMHAVTILFRDLGVDPYVHELDHDSEGKDMEKALVRMGCNVSVPAVFIGGKLVGSTNEVMSLHLKGS
LIQLLKPYLPD*
Predicted Coding Sequence 
ATGGCTGATAAGGTACAACGAATGTCATCAGAGCACGGXGGTGATGATTTTCAGCAAGAGTACGTGTTGTTTATGCACGCGGTCACTATA
CTATTTCGAGATCTTGGTGTTGATCCATATGTGCATGAACTTGATCATGATTCTGAGGGAAAAGATATGGAAAAAGCTCTTGTGAGGATG
GGTTGTAATGTCTCAGTTCCAGCAGTTTTTATAGGGGGGAAATTAGTTGGATCAACAAATGAAGTTATGTCACTTCATCTCAAAGGATCC
CTAATTCAACTCCTCAAGCCATATCTACCTGATTAA
Edits in Original Sequence 
GGGAGCCATCTAAATAAAGCACACCATCTTTTGAATCTTTACAATTTAGACAGAGAACTCCACTTTCATTTTTAGATGTTCCAATTTTTT
TTTCTTTTATAAATAGTGTAGCTATTAAAACCCTCTATTTCCAAGCAATCTCTTTAAAAAAAAAAATTAACAAGTTTTTTCTTGCTATTT
TTCTTCTTAATTCCTTCATCTCTTCTAGCATCAAATTTTATAACCATCGGATCGATGTTCAAATTCTGTTGAACTTAAGATCCGATGGTA
TACTAAAGAGTACCTCCATATTTACCCCTATATTTCAACAACTTTACGTATATACCAAAATATCAAGTATAGCTCGTAACAATCTATCCG
TTGAACTTCTAGGCCGATCAAATCAAATAAGGAAAAAAAACCCTAATATTTGAAAACTAACCCTACCACCTTTTTTACTCATATTTCATC
GTACTGCTAGTCGTTGTAA
(5')ATGGCTGATAAGGTACAACGAATGTCATCAGAGCACGGXGGTGATGATTTTCAGCAAGAGTACGTGT
TGTTTATGCtACGCGGTCACTATACTATTTCGAGATCTTGGTGTTGATCCATATGTGCATGAACTTGATCATGATTCTGAGGGAAAAGAT
ATGGAAAAAGCTCTTGTGAGGATGGGTTGTAATGTCTCAGTTCCAGCAGTTTTTATAGGGGGGAAATTAGTTGGATCAACAAATGAAGTT
ATGTCACTTCATCTCAAAGGATCCCTAATTCAACTCCTCAAGCCATATCTACCTGATTAA(3')AATAAAATAAATTGGAGAATTGGAGA
GTGAAATTATTCACCTTTAAAGGGAAATAAGAAAAAGAAAGTACTTAATGAATTAGGAGGATATATAATATTAAAGAAATTTAAAGGTTA
AAATAACAAACGAATAAAAGTTAATGGCTCAATCGACTAATGACACTAGTCATGTAGATCAAGGTCATGGTATAGTATATGATCAATGTT
GTAATAGTTTGTAAGTATATGTATTTTGTGAGATATTAATTGATCCTAATTATTAGTCATTTGAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan