ESTScan Details for Unigene SGN-U574908

Score 
757
Direction 
Forward
Predicted Peptide Sequence 
VSWCPAEIVSGNGHTYSVRYDYYTCMESEARSERVSRREIRPCPLPSKGVENGQSGQIIEVFNDCCWKTSIIVKVFNRDYYLVHPTGCSQ
EIRVHDRTPECDNAGKMKNGTXIGKGSGTCAKPDQLPAQRSYKKVSIVLSARNGFHVRDGDLAAQGNLKRKKCNASSLVLLKRVPDESSR
NIQEVVEGERDFKRRKIVPAALEGNTHDIPGGNGNWMDEKYVSASSNNWSDGYYGSNPAKRSGTNGYSPARIGESNDSDSDACSVGSCSI
NHESPNKISSFSAEVHCQVPDLLCSDAESFQSSAEEHEEESCRVSSEKNIAGNIRDLELHAYRCTLEALYASGPLSWEQEALLTNLRIAL
HISNDEHLTELRTLISSGTGIHVS*
Predicted Coding Sequence 
GTATCATGGTGTCCTGCAGAGATCGTATCGGGTAATGGACATACTTACTCTGTGAGGTATGATTATTATACTTGTATGGAAAGTGAAGCG
AGGTCTGAGAGGGTTTCGAGGAGGGAGATCAGACCATGCCCCCTTCCTTCAAAGGGTGTGGAGAATGGGCAAAGTGGTCAAATTATCGAG
GTGTTTAATGATTGTTGTTGGAAAACTTCTATTATTGTGAAGGTTTTCAATAGAGACTATTATTTAGTACACCCAACTGGATGTTCACAG
GAGATTAGAGTTCATGATCGAACACCAGAGTGCGACAATGCTGGCAAGATGAAAAATGGCACTXTGATTGGAAAGGGATCTGGAACGTGT
GCGAAACCTGACCAGCTTCCTGCTCAAAGATCTTATAAAAAGGTGAGCATTGTCTTAAGTGCTAGGAATGGATTTCATGTTAGAGATGGA
GATTTGGCTGCTCAGGGAAATCTTAAAAGGAAGAAGTGTAATGCTAGCTCTTTGGTGTTGCTGAAGAGGGTGCCAGACGAATCATCTAGA
AACATTCAGGAGGTAGTGGAAGGTGAGAGAGATTTTAAGAGACGTAAAATAGTTCCAGCTGCCTTGGAGGGGAACACACATGATATTCCA
GGTGGGAACGGAAATTGGATGGATGAGAAGTATGTGAGTGCTTCATCTAACAATTGGTCTGATGGATATTATGGTTCAAACCCTGCAAAA
AGAAGTGGTACCAATGGCTATTCCCCTGCAAGAATTGGAGAATCTAATGATTCTGATAGTGATGCATGCTCTGTTGGTAGTTGTAGTATT
AATCATGAGAGTCCAAATAAAATTTCTAGTTTTTCAGCTGAAGTTCATTGTCAAGTACCTGATCTTCTGTGCAGTGATGCAGAGTCCTTT
CAAAGTTCAGCAGAAGAACATGAGGAGGAAAGCTGCCGTGTTTCTTCGGAGAAAAATATAGCAGGGAATATTCGTGACTTGGAGTTGCAT
GCTTATCGCTGCACTTTGGAGGCATTGTATGCTTCTGGTCCCTTGAGTTGGGAACAAGAAGCGTTACTGACAAATCTCCGCATTGCACTT
CATATTTCAAATGACGAACATTTAACAGAGCTGAGGACTTTAATTTCTTCTGGAACTGGTATTCATGTCAGTTGA
Edits in Original Sequence 
(5')GTATCATGGTGTCCTGCAGAGATCGTATCGGGTAATGGACATACTTACTCTGTGAGGTATGATTATTATACTTGTATGGAAAGTGA
AGCGAGGTCTGAGAGGGTTTCGAGGAGGGAGATCAGACCATGCCCCCTTCCTTCAAAGGGTGTGGAGAATGGGCAAAGTGGTCAAATTAT
CGAGGTGTTTAATGATTGTTGTTGGAAAACTTCTATTATTGTGAAGGTTTTCAATAGAGACTATTATTTAGTACACCCAACTGGATGTTC
ACAGGAGATTAGAGTTCATaGATCGAACACCAGAGTGCGACAATGCTGGCAAGATGAAAAATGGCACTXTGATTGGAAAGGGATCTGGAA
CGTGTGCGAAACCTGACCAGCTTCCTGCTCAAAGATCTTATAAAAAGGTGAGCATTGTCTTAAGTGCTAGGAATGGATTTCATGTTAGAG
ATGGAGATTTGGCTGCTCAGGGAAATCTTAAAAGGAAGAAGTGTAATGCTAGCTCTTTGGTGTTGCTGAAGAGGGTGCCAGACGAATCAT
CTAGAAACATTCAGGAGGTAGTGGAAGGTGAGAGAGATTTTAAGAGACGTAAAATAGTTCCAGCTGCCTTGGAGGGGAACACACATGATA
TTaCCAGGTGGGAACGGAAATTGGATGGATGAGAAGTATGTGAGTGCTTCATCTAACAATTGGTCTGATGGATATTATGGTTCAAACCCT
GCAAAAAGAAGTGGTACCAATGGCTATTCCCCTGCAAGAATTGGAGAATCTAATGATTCTGATAGTGATGCATGCTCTGTTGGTAGTTGT
AGTATTAATCATGAGAGTCCAAATAAAATTTCTAGTTTTTCAGCTGAAGTTCATTGTCAAGTACCTGATCTTCTGTGCAGTGATGCAGAG
TCCTTTCAAAGTTCAGCAGAAGAACATGAGGAGGAAAGCTGCCGTGTTTCTTCGGAGAAAAATATAGCAGGGAATATTCGTGACTTGGAG
TTGCATGCTTATCGCTGCACTTTGGAGGCATTGTATGCTTCTGGTCCCTTGAGTTGGGAACAAGAAGCGTTACTGACAAATCTCCGCATT
GCACTTCATATTTCAAATGACGAACATTTAACAGAGCTGAGGACTTTAATTTCTTCTGGAACTGGTATTCATGTCAGTTGA(3')TAATT
AATTTCTCCATTTTGGCTTTCTTTTTTATGGTAGGACCACATCTATGTTTTGACTTGAGTAGCATTGTAAAAGCATGAAAATAGGTGACA
CATTTGTTAATTCTCTCTTTGTCGTTAATCTCCACTTTGTAGACAGTTGGCCAATTTGTAAGAATGTTATCATGCCGTATATCCTGGAAA
GGAAATGACTCAATTATTCTAAATTC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan