ESTScan Details for Unigene SGN-U575413

Score 
150
Direction 
Reverse
Predicted Peptide Sequence 
XDLSSNNMVGEIXIEIXISVGFARFEPVEHPFKGSIPLRIGEMKALNFLDLSTNDLTGEIPASLSQLSHLGVLNLSCNNLSGRIPLGEQL
LTFNNRSYIGNHGLCGYPLTEACSLEELPRDSTLSDEDEFITPEFYISMGISFISAFLGVSAHESSYKSRVLETLHLPEFLFDVHCTPHE
SANPXNIYTVRVVYLTFMSFSQAKPFILRSTIDHLSASKSKPHPLPPIWNSILIAPRAECSSPX
Predicted Coding Sequence 
XXCGATCTTTCAAGCAACAACATGGTGGGAGAAATCCNTATTGAAATTAXCATCTCTGTAGGGTTTGCACGGTTTGAACCTGTCGAGCAC
CCTTTTAAGGGCAGCATCCCTCTGAGGATTGGTGAAATGAAGGCACTGAATTTCCTAGACTTAAGTACAAATGATCTTACAGGGGAAATT
CCTGCTAGCCTTTCACAGTTAAGTCACTTGGGAGTCTTGAACTTGTCTTGCAACAACTTGTCTGGTCGAATCCCTTTAGGCGAACAGTTA
CTAACTTTCAACAACAGATCCTACATTGGCAATCATGGTCTTTGCGGCTATCCACTAACAGAAGCTTGCTCTCTGGAGGAACTTCCTCGA
GACTCAACGTTGAGTGATGAGGACGAGTTTATAACTCCAGAATTTTATATTAGTATGGGAATCAGCTTTATTTCTGCATTTTTGGGAGTC
TCAGCTCATGAAAGTAGCTATAAATCTCGAGTTCTTGAAACTTTGCATTTGCCTGAATTTTTATTCGATGTGCATTGTACACCACACGAA
TCAGCTAATCCTCXGAATATTTATACTGTACGAGTTGTTTATTTAACCTTTATGTCGTTTTCTCAAGCAAAACCATTCATTTTAAGGAGC
ACCATAGATCATCTGAGTGCAAGCAAGAGCAAACCTCATCCTCTGCCTCCCATTTGGAACTCAATATTGATAGCTCCTCGTGCCGAGTGC
AGCAGCCCGGXX
Edits in Original Sequence 
(5')XXCGATCTTTCAAGCAACAACATGGTGGGAGAAATCCNTATTGAAATTAXCATCTCTGTAGGGTTTGCACGGTTTGAACCTGTCGA
GCACCCTTTTAAcGGGCAGCATCCCTCTGAGGATTGGTGAAATGAAGGCACTGAATTTCCTAGACTTAAGTACAAATGATCTTACAGGGG
AAATTCCTGCTAGCCTTTCACAGTTAAGTCACTTGGGAGTCTTGAACTTGTCTTGCAACAACTTGTCTGGTCGAATCCCTTTAGGCGAAC
AGTTACTAACTTTCAACAACAGATCCTACATTGGCAATCATGGTCTTTGCGGCTATCCACTAACAGAAGCTTGCTCTCTGGAGGAACTTC
CTCGAGACTCAACGTTGAGTGATGAGGACGAGTTTATAACTCCAGAATTTTATATTAGTATGGGAATCAGCTTTATTTCTGCATTTTTGG
GAGTCTCAGCTCATGAtAAGTAGCTATAtAATCTCGAGTTCTTGAAACTTTGCATTTGCCTGAATTTTTATTCGATGTGCATTGTACACC
ACACGAATCAGCTAATCCTCXGAATATTTATACTGTACGAGTTGTTTATTTAACCTTTATGTCGTTTTCTCAAGCAAAACCATTCATTTT
AAGGAGCACCATAGATCATCTGAGTGCAAGCAAGAGCAAACCTCATCCTCTGCCTCCCATTTGGAACTCAATATTGATAGCTCCTCGTGC
CGAGTGCAGCAGCCCGGXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan