ESTScan Details for Unigene SGN-U575652

Score 
377
Direction 
Forward
Predicted Peptide Sequence 
MAFSATLDVHLLYTALRRIQQFQAFCLNHLLQSPFDLRLRFLIAKNHCLFDXATLEAAPASGGVAPAISLTDNALMHLNKMRSDRNEDLC
LRIGVKQGGCSGMSYTMEFEKRENARPDDSIIEYNGFVIVCDPKSLLFIFGMQLDYSDALIGGGFSFKNPNATQTCGCGKSFTAEM*
Predicted Coding Sequence 
ATGGCGTTCTCTGCAACTCTTGATGTTCATCTTCTCTACACCGCCCTTCGAAGAATTCAACAATTTCAAGCGTTTTGCCTCAATCATCTT
CTTCAATCTCCTTTCGATCTTCGCCTTCGTTTTTTAATCGCAAAAAATCATTGTCTATTCGATXCTGCTACACTTGAAGCAGCACCTGCA
TCTGGAGGAGTAGCACCTGCAATTTCCTTAACTGACAATGCATTAATGCACTTGAATAAAATGAGGAGTGATCGGAATGAGGACTTGTGT
CTTAGAATTGGCGTTAAACAAGGGGGATGCTCGGGAATGTCATACACTATGGAGTTTGAAAAGCGAGAAAATGCTAGACCAGACGATTCA
ATCATCGAGTACAATGGATTTGTTATTGTTTGTGATCCAAAAAGCCTTCTCTTCATCTTCGGAATGCAACTGGACTACAGCGATGCATTG
ATAGGCGGGGGCTTCTCTTTCAAAAATCCAAACGCTACGCAAACTTGTGGTTGTGGAAAATCGTTTACTGCTGAGATGTAA
Edits in Original Sequence 
CAAAAATGATCACAATTCAACTAGCACGTATGAATAAGCCATAAATAAATTATAGAACTGAAAATTAAAAAAAAAAAATTATCAATTGTG
TGATTTGCAGGTAACA
(5')ATGGCGTTCTCTGCAACTCTTcGATGTTCATCTTCTCTACACCGCCCTTCGAAGAATTCAACAATTTCAA
GCGTTTTGCCTCAATCATCTTCTTCAATCTCCTTTCGATCTTCGCCTTCGTTTTTTAATCGCAAAAAATCATTGTCTATTCGATXCTGCT
ACACTTGAAGCAGCACCTGCATCTGGAGGAGTAGCACCTGCAATTTCCTTAACTGACAATGCATTAATGCACTTGAATAAAATGAGGAGT
GATCGGAATGAGGACTTGTGTCTTAGAATTGGCGTTAAACAAGGGGGATGCTCGGGAATGTCATACACTATGGAGTTTGAAAAGCGAGAA
AATGCTAGACCAGACGATTCAATCATCGAGTACAATGGATTTGTTATTGTTTGTGATCCAAAAAGCCTTCTCTTCATCTTCGGAATGCAA
CTGGACTACAGCGATGCATTGATAGGCGGGGGCTTCTCTTTCAAAAATCCAAACGCTACGCAAACTTGTGGTTGTGGAAAATCGTTTACT
GCTGAGATGTAA(3')GAGCATGCAGTCTTAGAAATGTACTACAAAATTAACATACTAGAACACCAACTGTGGTTTGCTTGGTTCTCTGA
ATATAGACAGAGACAGTAATGAAGATCTGTTAACTCATATTATGTGCATAAGGGACTGTAACGTTTAAATATGTGTAACTGGGAATGCAT
TATATTCTTCCTGCACAAAATACAAAACATCTATGCCATGTCGATTTATGCTTCGTGAGGCAGAGCCGCAATGTAACATGTGGGTTCACG
TAAACTCAATAGTTTTGTGTTGGATCTTGTATATGCATTTTTAAAACATTATTAAAATGATGAAAGAATTGTGAACTCAATTATTATGAA
AAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan