ESTScan Details for Unigene SGN-U575653

Score 
160
Direction 
Reverse
Predicted Peptide Sequence 
MQLDYSDALIGGGFSFKNPNATQTCGCGKSFTAEM*
Predicted Coding Sequence 
ATGCAACTGGACTACAGCGATGCATTGATAGGCGGGGGCTTCTCTTTCAAAAATCCAAACGCTACGCAAACTTGTGGTTGTGGAAAATCG
TTTACTGCTGAGATGTAA
Edits in Original Sequence 
CTGTAAAGTTTGCTTCATTGATTAACTGATGCCGCTTGTGGTGTAAAAATTACCTATATTTAGCTCTTGTATGCTTCTAAAGCTAGCAGT
CATACCCATCTACTTAGATTAGTTCACTTTGAGACGAATTTTAATACCCTTGATTCAGTAAGTTCCCCTTGCCCATTGTGTGGCGTTTTT
TACTCATGAAGTAGTTAAAGCTTTTAGTGTTGGGTCCATACAAGAAACCAGTACTATTTCACTCTTATATTTGTAAGTTATGCGTGCTAG
CTACTTGTTTCTGTTTTCTTTTCGAGTGATTATTGACATTTAAATAAGAAATTTTTGTTGCATCAACCCTTTCTTTCAGTTTGTGATCCA
AAAAGCCTTCTCTTCATCTTCGGA
(5')ATGCAACTGGACTACAGCGATGCATTGATAGGCGGGGGCTTCTCTTTCAAAAATCCAAACGC
TACGCAAACTTGTGGTTGTGGAAAATCGTTTACTGCTGAGATGTAA(3')GAGCATGCAGTCTTAGAAATGTACTACAAAATTAACATAC
TAGAACACCAACTGTGGTTTGCTTGGTTCTCTGAATATAGACAGAGACAGTAATGAAGATCTGTTAACTCATATTATGTGCATAAGGGAC
TGTAACGTTTAAATATGTGTAACTGGGAATGCATTATATTCTTCCTGCACAAAATACAAAACATCTATGCCATGTCGTTTTATGCTTCGT
GAGGCAGAGCCGCAATGTAACGTGTGGGTTCATGTAAACTCAATAGTTTTGTGTTGGATCTTGTATATGTATTTTTAAAATATTATTAAA
TTTATGAAAGATTGTGAACTCGGTTATTATTATAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan