ESTScan Details for Unigene SGN-U575786

Score 
1089
Direction 
Forward
Predicted Peptide Sequence 
MGIKGLMKLLADNAPSGMKEQKFESYFGRKIAIDASMSIYQFLIVVGRSGTEMLTNEAGETTSHLVGDVFAAIRLLEAGIKPVYVFDGKP
PDLKKQELAKRYSRREDATDDLAKATESGNKEDIEKFSKRTVKVTSQHNDDCKKLLRLMGVPAVEAPSEAEAQCAALCKAEKVYAVASED
MDSLTFGAPKFLRHLMDPSSKKIPVMEFDISKVLEGLELSMDQFMTCAFFVDVITVIASEAWAPDGFEACTPTWVNGEHIENINKERYQI
PDDWPYEEARRLFKEPLVVTDDEQTELKWAAPDEEGLVNFLVKENGFNIDRVTKAIEKIKTAKNKSSQGRLESFFKPVSTSAPVKRKETS
HTTEKGAANKKSKAGGSKKKKXVSIKLSLQWSDGFVPWSVRVPSHIAACGVFGSWRLKFVWSSGRKYTD*
Predicted Coding Sequence 
ATGGGAATCAAGGGTTTAATGAAGCTGTTGGCTGACAATGCTCCAAGTGGAATGAAGGAGCAGAAGTTCGAGAGCTATTTCGGCCGTAAA
ATAGCCATCGACGCTAGTATGAGCATTTATCAGTTCCTGATTGTAGTAGGACGAAGCGGTACGGAAATGCTCACTAACGAAGCTGGGGAA
ACTACTAGTCATTTGGTCGGXGATGTTTTCGCGGCGATTAGGCTTTTGGAAGCTGGAATCAAGCCAGTTTATGTTTTTGATGGCAAGCCC
CCTGATTTGAAGAAACAAGAACTTGCAAAACGTTACTCTAGAAGGGAAGATGCCACAGATGACTTGGCTAAGGCTACAGAGAGTGGCAAC
AAGGAGGATATTGAGAAATTCAGCAAGAGAACAGTAAAGGTTACATCACAACACAATGATGACTGCAAAAAACTTCTCAGACTAATGGGG
GTACCTGCTGTTGAGGCTCCTTCTGAAGCAGAGGCTCAGTGTGCTGCACTTTGCAAGGCAGAAAAGGTTTATGCTGTGGCCTCAGAAGAT
ATGGATTCCTTAACTTTTGGAGCTCCAAAGTTTCTTCGCCATTTAATGGATCCTAGCTCCAAAAAGATACCAGTGATGGAATTTGACATC
TCCAAGGTATTGGAGGGACTTGAACTTAGTATGGATCAGTTCATGACTTGTGCATTCTTTGTGGATGTGATTACTGTGATAGCATCCGAG
GCATGGGCCCCAGACGGCTTTGAAGCTTGTACGCCAACATGGGTCAATGGAGAGCATATTGAGAATATTAACAAAGAGAGATATCAAATA
CCTGATGATTGGCCTTATGAAGAGGCTAGGCGGCTCTTCAAGGAACCATTAGTTGTTACAGATGATGAGCAAACTGAACTAAAATGGGCT
GCTCCTGATGAAGAAGGGTTGGTTAACTTTCTGGTAAAGGAAAATGGATTCAACATTGATAGAGTTACAAAGGCAATAGAAAAGATCAAG
ACAGCCAAGAACAAATCTTCTCAGGGGCGGTTAGAATCATTCTTTAAACCAGTTAGCACGTCTGCTCCAGTTAAAAGAAAGGAAACATCT
CACACCACTGAGAAAGGAGCTGCTAACAAGAAATCAAAGGCTGGTGGTAGTAAGAAGAAAAAGXTAGTTAGCATCAAGTTAAGCTTGCAG
TGGAGTGATGGTTTCGTACCTTGGTCAGTCAGAGTGCCCAGTCACATTGCTGCTTGTGGAGTCTTTGGTAGCTGGCGCCTCAAATTTGTT
TGGTCTTCTGGAAGAAAATACACCGATTAG
Edits in Original Sequence 
GAAAACTTAAACCCTAGTACCCAACCTTCAAGAAATTGGCTGAAGCTTTCTGAGTTCGTTCTATCCAAAAA(5')ATGGGAATCAAGGGT
TTAATGAAGCTGTTGGCTGACAATGCTCCAAGTGGAATGAAGGAGCAGAAGTTCGAGAGCTATTTCGGCCGTAAAATAGCCATCGACGCT
AGTATGAGCATTTATCAGTTCCTGATTGTAGTAGGACGAAGCGGTACGGAAATGCTCACTAACGAAGCTGGGGAAACTACTAGTCATTTG
GTCGGXGATGTTTTCGCGGaCGATTAGGCTTTTGGAAGCTGGAATCAAGCCAGTTTATGTTTTTGATGGCAAGCCCCCTGATTTGAAGAA
ACAAGAACTTGCAAAACGTTACTCTAGAAGGGAAGATGCCACAGATGACTTGGCTAAGGCTACAGAGAGTGGCAACAAGGAGGATATTGA
GAAATTCAGCAAGAGAACAGTAAAGGTTACATCACAACACAATGATGACTGCAAAAAACTTCTCAGACTAATGGGGGTACCTGCTGTTGA
GGCTCCTTCTGAAGCAGAGGCTCAGTGTGCTGCACTTTGCAAGGCAGAAAAGGTTTATGCTGTGGCCTCAGAAGATATGGATTCCTTAAC
TTTTGGAGCTCCAAAGTTTCTTCGCCATTTAATGGATCCTAGCTCCAAAAAGATACCAGTGATGGAATTTGACATCTCCAAGGTATTGGA
GGGACTTGAACTTAGTATGGATCAGTTCATaGACTTGTGCATTCTTTGTGGATGTGATTACTGTGATAGCATCCGAGGCATaGGGCCCCA
GACGGCTTTGAAGCTTGTACGCCAACATGGGTCAATGGAGAGCATATTaGAGAATATTAACAAAGAGAGATATCAAATACCTGATGATTG
GCCTTATGAAGAGGCTAGGCGGCTCTTCAAGGAACCATTAGTTGTTACAGATGATGAGCAAACTGAACTAAAATGGGCTGCTCCTGATGA
AGAAGGGTTGGTTAACTTTCTGGTAAAGGAAAATGGATTCAACATTGATAGAGTTACAAAGGCAATAGAAAAGATCAAGACAGCCAAGAA
CAAATCTTCTCAGGGGCGGTTAGAATCATTCTTTAAACCAGTTAGCACGTCTGCTCCAGTTAAAAGAAAGGAAACATCTCACACCACTGA
GAAAGGAGCTGCTAACAAGAAATCAAAGGCTGGTGGTAGTAAGAAGAAAAAGXTAGTTAGCATCAAGTTaAAGCTTGCAGTGGAGTGATG
GTTTCGTACCTTGGTCAGTCAGAGTGCCCAGTCACATTGCTGCTTGTGGAGTCTTTGGTAGCTGGCGCCTCAAATTTGTTTGGTCTTCTG
GAAGAAAATACACCGATTAG(3')TCAGGCTTTGTTTCAAGTGTCTCGTTTATTTTCTTTTCTTCTGTATCTCTCCACCCTGCCCTCTTT
TTCAATCAATGAGTGTATAAATCTGGATTATCCTGGGTTCTCATCCTATGTGAATTTGGCATTTCTGTAGGTTACATGTACACCATTTAA
TGCATAAAACCGCTCTTAATC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan