ESTScan Details for Unigene SGN-U575916

Score 
543
Direction 
Forward
Predicted Peptide Sequence 
MVEKGEKPTVISYGALLSALEKGKLYDEALQVWKHMIKVGIEPNLYAYTIMASIYTAQGKFNIVDSIIKEMVTTGVEPTVVTFNAIISGC
ARNGMESVAYEWFQRMKTQNITPNEVSYEVLIEALANDGKPRLAYELYVRALTEGLSLSTKAYDAVISSTQAYGASIDLSILGPRPPEKK
KRVQIRKSLSEFCHIADFPEEAGPLTGKKFXTAQTKGT*
Predicted Coding Sequence 
ATGGTAGAGAAAGGTGAAAAACCTACAGTTATATCCTATGGAGCGTTGCTCAGTGCTCTAGAAAAAGGCAAGCTCTATGATGAAGCTCTT
CAGGTTTGGAAACATATGATCAAAGTGGGGATCGAGCCAAATTTGTATGCCTATACTATTATGGCATCAATTTACACTGCTCAAGGGAAA
TTTAACATAGTTGATTCTATCATCAAGGAGATGGTTACTACTGGAGTTGAGCCTACAGTTGTTACATTCAACGCTATTATTAGTGGATGT
GCTCGGAATGGTATGGAAAGTGTTGCATACGAGTGGTTTCAGCGTATGAAAACTCAAAACATAACCCCGAATGAGGTAAGCTATGAAGTG
CTAATTGAGGCTCTTGCCAATGATGGCAAGCCGAGGCTAGCATATGAGTTGTATGTGAGAGCTCTAACTGAAGGCCTGAGTCTTTCTACA
AAGGCTTATGATGCAGTCATCTCATCTACACAGGCATATGGTGCAAGTATTGATCTAAGCATTCTTGGCCCCCGCCCACCAGAAAAAAAG
AAACGAGTGCAAATCAGGAAAAGTTTGTCTGAATTCTGTCATATAGCCGATTTCCCAGAAGAAGCAGGCCCTTTGACAGGGAAGAAATTT
XTTACTGCTCAGACAAAAGGAACATGA
Edits in Original Sequence 
GA(5')ATGGTAGAGAAAGGTGAAAAACCTACAGTTATATCCTATGGAGCGTTGCTCAGTGCTCTAGAAAAAGGCAAGCTCTATGATGAA
GCTCTTCAGGTTTGGAAACATATGATCAAAGTGGGGATCGAGCCAAATTTGTATGCCTATACTATTATGGCATCAATTTACACTGCTCAA
GGGAAATTTAACATAGTTGATTCTATCATCAAGGAGATGGTTACTACTGGAGTTGAGCCTACAGTTGTTACATTCAACGCTATTATTAGT
GGATGTGCTCGGAATGGTATGGAAAGTGTTGCATACGAGTGGTTTCAGCGTATGAAAACTCAAAACATAACCCCGAATGAGGTAAGCTAT
GAAGTGCTAATTGAGGCTCTTGCCAATGATGGCAAGCCGAGGCTAGCATATGAGTTGTATGTGAGAGCTCTAACTGAAGGCCTGAGTCTT
TCTACAAAGGCTTATGATGCAGTCATCTCATCTACACAGGCATATGGTGCAAGTATTGATCTAAGCATTCTTGGCCCCCGCCCACCAGAA
AAAAAGAAACGAGTGCAAATCAGGAAAAGTTTGTCTGAATTCTGTCATATAGCCGATgTTCCCAGAAGAAGCAGGCCCTTTGACAGGGAA
GAAATTTXTTACTGCTCAGACAAAAGGAACATGA(3')TAAGCACAACTTTATATTGCTAGTGTGTGTAAGTATACAACTCATTGTTTAT
ATGTTGTGCTGTTTTCAACAAAAAGTGTATGCTTCCTCTTGCGTAAAGCTACATTAGTTGATTGACTTTAGATGCAAAATCAGGCTTATC
CCAATTACCTTTTCACCTCTATCCTGGATTCAAGCATTCATTTTTTTTTTTGCACTTTCAATATATAAACCGCCCCATCATATTATTATC
AATTTATACAATATGCCTCCCTTTAATTTGCGAATCAAATACAGTCATGCCTCCGAAAGTGTTCGTTCAAAACTCAACCTTGACAAAAAA
CACTAGTTGATTTTTTCCCTTTGTCCTAGCTTTAGTGGAAATAGTTTATTCATACTTATTGCTGGGGTGAAATGGCATGTACCAACTTTG
CTAATTTTGTTCCCTTTGTACTGAAAAAGTTGAAACCCTTCCTTTTGTACTGAAAAAGTTGAAACCCTTTAAAGTTGTTTCCATAAAATT
TCAGGCTGACAGGTAATTTGAGGAAGCATATTAATATTTTTTTTGTACAACTACCAAAAAGCTTGCTAGAATCAATTCCTTGACATATGT
TTGATGTAAGTATTTATTGAACTAAATTTTTTTGTCC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan