ESTScan Details for Unigene SGN-U575923

Score 
1100
Direction 
Forward
Predicted Peptide Sequence 
XAYFQSRQKGKIVQSPEHNGIPFPATNNNYIKVFGPKEKREEKMALRLTPFLLPTYGKPKLAALFNSRSELSIQFLSKNFRMLDFESRKM
GLKVSASQKLEEKNVPESGSQWGKVSAVLFDMDGVLCNSEESSRKAAVDVFAEMGVQVTVEDFVPFMGMGEANFLGGVAAAKGVEGFDTE
AAKKRFFEIYLSKYAKPNSGIGFPGAFELVSQCKSSGLKVAVASSADRIKVDANLAAAGLPITMFDAIVSADAFKNLKPAPDIFLAASRI
LDVPTSECIVIEDALAGVQAAKAAKMRCIAVTTTLSEDTLNAAEPSLIRKEISDISLEDILNGGSGSHXYVVHRHVKNFPFMYHLQM*
Predicted Coding Sequence 
XXCGCTTACTTTCAAAGCAGACAAAAGGGTAAAATAGTACAATCACCGGAACACAACGGCATCCCCTTCCCCGCCACCAATAACAATTAT
ATAAAGGTTTTCGGGCCAAAAGAAAAGAGAGAGGAAAAAATGGCGTTAAGGCTTACACCTTTTCTACTGCCCACTTATGGAAAACCCAAA
CTAGCTGCACTTTTCAATTCAAGATCCGAATTATCCATTCAATTTCTTTCAAAAAACTTCAGAATGTTGGATTTTGAATCAAGAAAGATG
GGTTTAAAGGTGAGTGCTTCCCAAAAATTGGAAGAGAAGAATGTACCGGAGTCGGGTAGCCAATGGGGGAAAGTGTCGGCAGTGTTGTTT
GATATGGATGGTGTGCTCTGCAATAGTGAGGAATCGTCAAGAAAAGCGGCTGTTGATGTTTTTGCTGAGATGGGTGTTCAAGTAACCGTT
GAAGACTTTGTGCCTTTCATGGGCATGGGTGAAGCAAACTTCTTAGGTGGTGTTGCTGCTGCTAAGGGTGTTGAAGGATTTGATACCGAG
GCTGCAAAGAAGAGGTTCTTTGAGATATATTTATCAAAGTATGCAAAACCGAATTCTGGCATTGGTTTCCCTGGTGCCTTTGAACTTGTC
TCTCAGTGTAAAAGCAGTGGTCTCAAAGTTGCTGTTGCATCTAGTGCTGACCGGATTAAAGTTGATGCAAACTTGGCTGCAGCCGGTTTA
CCAATAACGATGTTTGATGCAATTGTATCAGCTGATGCTTTTAAAAATTTGAAGCCTGCTCCTGATATTTTCTTGGCTGCATCACGGATT
CTTGATGTTCCCACTAGTGAGTGTATTGTGATTGAAGATGCACTAGCTGGAGTACAAGCTGCCAAAGCTGCAAAAATGAGATGTATAGCA
GTGACGACAACACTATCAGAAGATACTCTAAATGCGGCGGAGCCATCACTCATCAGAAAGGAGATAAGTGATATTTCACTTGAAGATATC
CTCAATGGTGGCTCTGGTAGCCATAGXTATGTAGTTCACCGACATGTTAAGAACTTCCCTTTCATGTACCATTTACAAATGTAG
Edits in Original Sequence 
(5')XXCGCTTACTTTCAAAGCAGACAAAAGGGTAAAATAGTACAATCACaCGGAACACAACGGCATCCCCTTCCCCGCCACtCAATAAC
AATTATATAAAGGTTTTCGGGCCAAAAGAAAAGAGAGAGGAAAAAATGGCGTTAAGGCTTACACCTTTTCTACTGCCCACTTATGGAAAA
CCCAAACTAGCTGCACTTTTCAATTCAAGATCCGAATTATCCATTCAATTTCTTTCAAAAAACTTCAGAATGTTGGATTTTGAATCAAGA
AAGATGGGTTTAAAGGTGAGTGCTTCCCAAAAATTGGAAGAGAAGAATGTACCGGAGTCGGGTAGCCAATGGGGGAAAGTGTCGGCAGTG
TTGTTTGATATGGATGGTGTGCTCTGCAATAGTGAGGAATCGTCAAGAAAAGCGGCTGTTGATGTTTTTGCTGAGATGGGTGTTCAAGTA
ACCGTTGAAGACTTTGTGCCTTTCATGGGCATGGGTGAAGCAAACTTCTTAGGTGGTGTTGCTGCTGCTAAGGGTGTTGAAGGATTTGAT
ACCGAGGCTGCAAAGAAGAGGTTCTTTGAGATATATTTATCAAAGTATGCAAAACCGAATTCTGGCATTGGTTTCCCTGGTGCCTTTGAA
CTTGTCTCTCAGTGTAAAAGCAGTGGTCTCAAAGTTGCTGTTGCATCTAGTGCTGACCGGATTAAAGTTGATGCAAACTTGGCTGCAGCC
GGTTTACCAATAACGATGTTTGATGCAATTGTATCAGCTGATGCTTTTAAAAATTTGAAGCCTGCTCCTGATATTTTCTTGGCTGCATCA
CGGATTCTTGATGTTCCCACTAGTGAGTGTATTGTGATTGAAGATGCACTAGCTGGAGTACAAGCTGCCAAAGCTGCAAAAATGAGATGT
ATAGCAGTGACGACAACACTATCAGAAGATACTCTAAATGCGGCGGAGCCATCACTCATCAGAAAGGAGATAAGTGATATTTCACTTGAA
GATATCCTCAATGGTGGCTCTGGTAGCCATAGXTATGTAGTTCACCGACATGTTAAGAACTTCCCTTTCATGTACCATTTACAAATGTAG
(3')AATACTGAAGCTCTTTTTTTTTTTTTTTATGGAAAAACTTGCGAGTAAGCTCTTTTTTGTAATGACTGTAATTTGTTGAAGGATGT
CCTGTTCTCTGTTCCCTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan