ESTScan Details for Unigene SGN-U575969

Score 
1690
Direction 
Forward
Predicted Peptide Sequence 
XKYELFIESELTVEVYRSEMAEVSGDNSYNVRQPTSDTAGYTTPLTVSASFKEGKTYRRRTSMRPSLDADEFLNLLHGSDPVKLELNRLE
NELRDKDRELSEAQAEIKSLRLSERLREKAVEELTDEWSRVDEKLKLTESLLESKNLEIKKINEEKKASMAAQFAAEATLRRVHAAQKDD
DMPPIEAILAPLEAELKLARQEIAKLQDDNKALDRLTKSKEAALLDAERTVQSALAKASMVDDLQNKNQDLMKQIEICQEENKILDRMHR
QKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKVQEMNEERKTLDRELARAKVTANRVATVVANEWKDASDKVMPVKQWLEERKFLQ
GELQQLRDKLAISERTAKSEAQLKEKYHLRLKVLEETLKSTSTGAALYQMEEVQATVLRVGDHXGGADNISKLTSNGILPKRSPSFQLRS
SGASTVLKHAKGTSKSFDGGSRSLDRSKKLLNGTGPNFNSSKSCDVSKDNETESNSWKANQDEKHNDSQMARTEDTVPGVLYDLLQKEVI
ALRKAGHEKDQSLNDKDDAIEMLAKKVETLTKAMEVEAKKMRREVAAMEKEVSAMRVEKEQENRAKRFANSKGPVNSSQPLPGRNVARNG
LMEAHNNIQGKTRRGSCKKQLCIGLVTFECASDLGYDPSTVSDQQNGTQAIEVELTVW
Predicted Coding Sequence 
XXGAAATATGAATTATTCATTGAAAGTGAGCTTACCGTAGAAGTTTATAGATCGGAGATGGCGGAGGTTTCCGGCGATAACAGCTACAAT
GTGCGACAGCCGACGAGTGACACAGCAGGTTATACAACGCCGTTGACGGTATCAGCTTCGTTCAAGGAAGGGAAGACTTACCGGAGAAGG
ACGTCCATGAGGCCAAGCCTTGACGCCGATGAGTTCTTAAACCTTCTCCACGGATCGGATCCGGTGAAATTGGAGCTTAATCGACTGGAG
AATGAACTTAGAGATAAGGACCGAGAATTGTCTGAGGCTCAGGCGGAGATCAAGTCATTGAGATTGTCAGAGCGCTTACGAGAAAAGGCT
GTTGAAGAGCTTACGGACGAGTGGTCAAGGGTTGACGAGAAGCTCAAGCTGACTGAGTCTCTTTTGGAAAGCAAGAATCTTGAAATTAAG
AAAATTAATGAAGAGAAAAAGGCATCCATGGCAGCGCAGTTTGCAGCAGAAGCCACCCTTCGAAGGGTTCATGCTGCTCAAAAAGATGAT
GATATGCCTCCAATTGAAGCCATTCTTGCACCTTTGGAGGCTGAACTCAAGCTTGCTCGCCAGGAGATTGCAAAGCTACAAGATGATAAT
AAAGCACTGGACCGTCTTACTAAGTCAAAAGAAGCAGCTCTACTTGATGCTGAGAGAACAGTGCAGTCAGCATTAGCAAAGGCTTCTATG
GTGGATGATCTTCAGAACAAGAATCAGGACTTGATGAAACAGATAGAGATATGCCAGGAAGAAAATAAAATATTAGACAGAATGCATCGA
CAAAAAGTTGCAGAGGTTGAAAAGCTTACCCAAACTGTACGTGAGCTTGAAGAGGCTGTTCTTGCTGGCGGTGCTGCTGCTAATGCTGTC
CGGGATTACCAAAGAAAAGTTCAAGAGATGAATGAAGAACGAAAAACTCTTGACCGGGAGCTAGCACGTGCCAAGGTTACAGCTAATAGG
GTAGCAACCGTGGTTGCTAATGAATGGAAAGATGCCAGTGATAAAGTAATGCCTGTTAAACAGTGGCTTGAAGAAAGGAAGTTTCTGCAG
GGTGAGTTGCAACAGTTACGCGACAAGCTTGCAATCTCTGAACGAACTGCGAAATCTGAAGCCCAGTTGAAAGAGAAATATCATTTAAGG
CTCAAGGTCCTTGAAGAGACATTAAAATCAACTAGCACAGGCGCCGCACTATACCAGATGGAAGAAGTTCAAGCAACGGTCCTTCGCGTC
GGCGATCACXTGGGTGGTGCTGACAACATCTCCAAATTGACCTCCAATGGTATCTTACCCAAGAGATCACCATCATTTCAGCTGAGATCT
TCTGGGGCCAGTACAGTGTTGAAGCATGCTAAAGGGACATCTAAGTCGTTTGATGGTGGTTCAAGATCTTTGGACAGGAGTAAAAAACTT
CTGAATGGAACAGGTCCAAATTTCAACAGCAGCAAGTCATGTGATGTGTCCAAAGACAATGAGACTGAAAGCAATTCATGGAAAGCGAAT
CAAGATGAAAAACACAATGACTCGCAAATGGCAAGAACAGAGGATACTGTGCCAGGAGTTTTATATGATTTGCTGCAAAAAGAAGTAATT
GCCTTGAGGAAAGCTGGTCATGAGAAGGATCAAAGTCTTAATGACAAAGACGACGCTATTGAGATGTTAGCAAAGAAAGTAGAGACTTTA
ACAAAAGCCATGGAAGTTGAGGCCAAAAAGATGAGAAGGGAAGTCGCTGCGATGGAGAAGGAGGTTTCTGCCATGCGTGTTGAGAAGGAA
CAAGAAAATAGAGCAAAAAGATTTGCAAATTCTAAGGGCCCAGTTAACAGTTCTCAGCCACTTCCAGGAAGGAATGTAGCACGGAATGGA
TTAATGGAGGCACACAATAACATTCAAGGGAAAACCCGTAGAGGCAGCTGTAAGAAGCAACTCTGCATAGGCTTGGTGACATTTGAGTGT
GCCTCTGACTTAGGCTATGATCCAAGCACGGTAAGCGATCAGCAGAACGGAACTCAAGCTATTGAAGTTGAATTAACCGTTTGG
Edits in Original Sequence 
(5')XXGAAATATGAATTATTCATTGAAAGTGAGCTTACCGTAGAAGTTTATAGATCGGAGATGGCGGAGGTTTCCGGCGATAACAGCTA
CAATGTGCGACAGCCGACGAGTGACACAGCAGGTTATACAACGCCGTTGACGGTATCAGCTTCGTTCAAGGAAGGGAAGACTTACCGGAG
AAGGACGTCCATGAGGCCAAGCCTTGACGCCGATGAGTTCTTAAACCTTCTCCACGGATCGGATCCGGTGAAATTGGAGCTTAATCGACT
GGAGAATGAACTTAGAGATAAGGACCGAGAATTGTCTGAGGCTCAGGCGGAGATCAAGTCATTGAGATTGTCAGAGCGCTTACGAGAAAA
GGCTGTTGAAGAGCTTACGGACGAGTGGTCAAGGGTTGACGAGAAGCTCAAGCTGACTGAGTCTCTTTTGGAAAGCAAGAATCTTGAAAT
TAAGAAAATTAATGAAGAGAAAAAGGCATCCATGGCAGCGCAGTTTGCAGCAGAAGCCACCCTTCGAAGGGTTCATGCTGCTCAAAAAGA
TGATGATATGCCTCCAATTGAAGCCATTCTTGCACCTTTGGAGGCTGAACTCAAGCTTGCTCGCCAGGAGATTGCAAAGCTACAAGATGA
TAATAAAGCACTGGACCGTCTTACTAAGTCAAAAGAAGCAGCTCTACTTGATGCTGAGAGAACAGTGCAGTCAGCATTAGCAAAGGCTTC
TATGGTGGATGATCTTCAGAACAAGAATCAGGACTTGATGAAACAGATAGAGATATGCCAGGAAGAAAATAAAATATTAGACAGAATGCA
TCGACAAAAAGTTGCAGAGGTTGAAAAGCTTACCCAAACTGTACGTGAGCTTGAAGAGGCTGTTCTTGCTGGCGGTGCTGCTGCTAATGC
TGTCCGGGATTACCAAAGAAAAGTTCAAGAGATGAATGAAGAACGAAAAACTCTTGACCGGGAGCTAGCACGTGCCAAGGTTACAGCTAA
TAGGGTAGCAACCGTGGTTGCTAATGAATGGAAAGATGCCAGTGATAAAGTAATGCCTGTTAAACAGTGGCTTGAAGAAAGGAAGTTTCT
GCAGGGTGAGTTGCAACAGTTACGCGACAAGCTTGCAATCTCTGAACGAACTGCGAAATCTGAAGCCCAGTTGAAAGAGAAATATCATTT
AAGGCTCAAGGTCCTTGAAGAGACATTAAAATCAACTAGCACAGGCGcCCGCACTATACCAGATGGAAGAAGTTCAAGCAACGGTCCTTC
GCGTCGGCGATCACXTGGGTGGTGCTGACAACATCTCCAAATTGACCTCCAATGGTATCTTACCCAAGAGATCACCATCATTTCAGCTGA
GATCTTCTGGGGCCAGTACAGTGTTGAAGCATGCTAAAGGGACATCTAAGTCGTTTGATGGTGGTTCAAGATCTTTGGACAGGAGTAAAA
AACTTCTGAATGGAACAGGTCCAAATTTCAACAGCAGCAAGTCATGTGATGTGTCCAAAGACAATGAGACTGAAAGCAATTCATGGAAAG
CGAATCAAGATGAAAAACACAATGACTCGCAAATGGCAAGAACAGAGGATACTGTGCCAGGAGTTTTATATGATTTGCTGCAAAAAGAAG
TAATTGCCTTGAGGAAAGCTGGTCATGAGAAGGATCAAAGTCTTAATGACAAAGACGACGCTATTGAGATGTTAGCAAAGAAAGTAGAGA
CTTTAACAAAAGCCATGGAAGTTGAGGCCAAAAAGATGAGAAGGGAAGTCGCTGCGATGGAGAAGGAGGTTTCTGCCATGCGTGTTGAGA
AGGAACAAGAAAATAGAGCAAAAAGATTTGCAAATTCTAAGGGCCCAGTTAACAGTTCTCAGCCACTTCCAGGAAGGAATGTAGCACGGA
ATGGATTAATGcGAGGCACACAATAACATTCAAGGGAAAACCCGTAGAGGCAGCTGTAAGAAGCAACTCTGCATAGGCTTGGTGACATTT
GAGTGTGCCTCTGACTTAGGCTATGATCCAAGCACGGTAAGCGATCAGCAcGAACGGAACTCAAGCTATTGAAGTTGAATTAACCGTTTG
G(3')CAGAATATTTTCTATTGTAGTAATTGTGTGGTTGTATAGATAGCTTGTGTTGGCACTTACTTCGCCTACTTTATTCCATGTTGTT
TGCAGTCTATATTTGTAATCTGCAGCTCAAGTGATATGTTATTGGTTCAGGTTTGTCAATATTCTAGTAATCAGATC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan