ESTScan Details for Unigene SGN-U576241

Score 
2282
Direction 
Forward
Predicted Peptide Sequence 
DTKLPPNLSTATTPSPLLSPANHRASLAVDISGEDFAYHPXVALAKGPFYWSSESVLLVPSRFCNXNSEFWIHKFESWIRNYDGGGDPXS
ASAAPAPTAATATIPATTPATTPATAAATTSATAPATTPATAPATAPATTPPHFGEFPRGPQPLPGPPPMMRQPSASSTTLNSQLPGPPP
HPSYDAHADSFAAKRMRKIGQRRAVDYTSTVVRYMQIRMWQRDSRDRTVLQPSPAAAVDILPAVAYLDNPSTSFAAKFVHTSLNKNLVQS
IVLRGXPSGRRLVTGSQSGEFTLWNGQSFNFEMILQAHDQAVRSMVWSHNDNWMVTGDDGGTIKYWQNNMNNVKAHKNAHKESIRELSFC
STDLKFCSCSDDTTVKIWDFARCQEERSLSGHGWDVKSVDWHPTKSLLVSGGKDNLVKLWDAKSGKELSSFHGHKNTVLCVKWNQNGNWV
LTASKDQIIKLYDIRAMKEVESFRGHQKDVTSLAWHPFHEEYFVSGSFDGSIFHWLVGHEAPQVEITNAHETGVWDLAWHPIGYLLCSGS
NDQTTKFWCRNRPGDSARDKFNLGQQGLGDQHNVLGRMPGNFPGPEPPSTPGAFASGMLRTEGTIPGVGAAMPLSIPSLDSPSQGEQKTS
MPLGAPPLPPGPHPSLLASNQQQAYQQNMQQAQQQSLPQQMTSLPLQPPNLPQLQPPHMPLMPHPHLPRPPHQLQPVNMPGIQSSMPGSG
PIQGMPPMGIQGNMNQMGPPMPQGHFVGMPPGSGPQGNVPPGGMPNGLPNMQGPQNAGGNQMFPPVRGFNRPQAGQMPLMPGLNPYQQSG
NPNTPPGMHMQSNFGHQSGMPPPLPPGPPPHNQGHQ*
Predicted Coding Sequence 
GACACTAAATTACCACCAAACCTGTCCACTGCTACTACACCCTCGCCGTTGCTCTCTCCGGCGAATCATCGCGCTTCCCTCGCCGTTGAT
ATCTCCGGCGAAGATTTTGCCTACCATCCAXTTGTAGCACTAGCTAAAGGTCCTTTTTACTGGAGTTCCGAATCTGTGTTGCTGGTTCCT
TCACGTTTCTGTAACXTGAACTCTGAATTTTGGATCCATAAATTTGAATCTTGGATCCGCAACTATGATGGCGGTGGTGATCCTXCATCA
GCATCAGCAGCACCAGCACCCACCGCTGCCACAGCAACAATTCCAGCAACAACACCAGCAACAACCCCAGCAACAGCCGCAGCAACAACA
TCAGCAACAGCCCCAGCAACAACACCAGCAACAGCACCAGCAACTGCACCAGCAACAACCCCTCCACATTTTGGAGAGTTTCCAAGGGGT
CCACAACCTCTGCCAGGTCCACCACCCATGATGCGGCAGCCATCTGCATCCTCCACTACTCTTAACTCTCAGCTACCTGGACCTCCTCCT
CATCCTTCTTATGACGCTCATGCTGACAGTTTTGCTGCAAAGAGAATGAGAAAAATTGGCCAGAGAAGAGCAGTTGACTACACCAGTACA
GTTGTAAGATATATGCAGATCCGCATGTGGCAGCGCGATTCAAGGGATAGGACAGTGTTACAACCGAGCCCAGCAGCAGCAGTTGATATA
TTGCCAGCAGTTGCCTATTTGGATAATCCATCTACAAGTTTTGCTGCTAAATTTGTTCATACATCTCTAAATAAAAACCTTGTTCAATCA
ATTGTCTTGCGTGGAXCTCCTAGTGGGCGGCGCCTTGTTACTGGATCTCAAAGTGGTGAATTCACACTATGGAATGGGCAATCATTTAAC
TTTGAAATGATTCTTCAGGCTCATGATCAAGCAGTCAGGTCAATGGTATGGAGCCACAATGATAACTGGATGGTCACTGGTGATGACGGG
GGCACAATAAAGTATTGGCAAAACAATATGAATAATGTCAAAGCCCATAAGAATGCACATAAAGAATCAATACGGGAATTGAGCTTCTGT
AGTACAGATTTAAAATTCTGCTCCTGCTCTGACGACACTACCGTTAAAATATGGGACTTCGCAAGGTGCCAAGAAGAGCGCTCATTATCT
GGCCACGGTTGGGATGTGAAGAGTGTTGATTGGCACCCTACAAAGTCTCTCTTAGTCTCAGGTGGAAAAGATAATCTTGTTAAACTTTGG
GATGCCAAGTCAGGAAAGGAGCTTTCATCATTTCATGGACATAAGAATACCGTTCTCTGTGTAAAGTGGAATCAAAATGGTAACTGGGTC
CTTACTGCTTCCAAGGATCAAATTATCAAGCTTTATGACATACGTGCTATGAAGGAGGTTGAGTCATTCCGAGGGCATCAGAAGGATGTG
ACATCACTGGCCTGGCATCCATTTCATGAAGAATATTTCGTCAGTGGAAGCTTTGATGGTTCAATATTTCATTGGCTTGTGGGGCATGAA
GCTCCTCAAGTAGAAATCACAAATGCACATGAAACTGGTGTTTGGGATCTTGCGTGGCACCCCATTGGCTATCTCCTTTGCAGCGGTAGT
AATGATCAGACAACAAAGTTCTGGTGCAGAAATAGGCCTGGGGACTCCGCTCGTGATAAATTCAATTTAGGACAACAAGGTTTGGGTGAT
CAACACAATGTTCTTGGTCGCATGCCTGGTAATTTTCCAGGTCCTGAGCCCCCATCAACTCCTGGAGCATTTGCCTCTGGTATGTTACGA
ACGGAGGGTACAATACCTGGAGTTGGAGCTGCAATGCCACTGTCTATCCCGTCACTTGATTCACCTTCTCAAGGAGAACAGAAGACTTCA
ATGCCTTTAGGAGCTCCTCCCCTTCCTCCTGGTCCACATCCATCGCTTCTTGCAAGTAATCAGCAGCAAGCATATCAACAAAACATGCAG
CAAGCTCAGCAGCAGTCACTGCCTCAACAAATGACTTCTCTTCCTTTGCAACCACCGAATTTGCCACAGCTACAGCCTCCACATATGCCT
CTAATGCCACATCCTCATCTACCTCGGCCACCACATCAACTACAACCAGTAAACATGCCCGGCATTCAGTCTTCAATGCCAGGATCTGGA
CCCATCCAAGGAATGCCTCCGATGGGGATACAAGGTAACATGAATCAGATGGGCCCTCCAATGCCTCAAGGTCATTTTGTTGGCATGCCT
CCTGGATCTGGACCGCAGGGCAATGTTCCCCCTGGTGGAATGCCAAATGGATTGCCAAACATGCAAGGCCCTCAAAATGCAGGAGGCAAT
CAGATGTTTCCACCAGTACGAGGCTTCAACAGGCCACAAGCTGGACAGATGCCGCTCATGCCTGGACTTAATCCTTATCAGCAATCTGGA
AATCCAAACACACCTCCTGGAATGCACATGCAGTCAAACTTTGGTCATCAATCTGGAATGCCTCCGCCACTGCCGCCAGGGCCTCCACCA
CATAATCAAGGACATCAATAG
Edits in Original Sequence 
(5')GACACTAAATTACCACCAAACCTGTCCACTGCTACTACACCCTCGCCGTTGCTCTCTCCGGCGAATaCATCGCGCTTCCCTCGCCG
TTGATATCTCCGGCGAAGATTTTGCCTACCATCCAXTTGTAGCACTAGCTAAAGGTCCTTTTTACTGGAGTTCCGAATCTGTGTTGCTGG
TTCCTTCACGTTTCTGTAACXTGAACTCTGAATTTTGGATCCATAAATTTGAATCTTGGATCCGCAACTATGATGGCGaGTGGTGATCCT
XCATCAGCATCAGCAGCACCAGCACCCACCGCTGCCACAGCAACAATTCCAGCAACAACACCAGCAACAACCCCAGCAACAGCCGCAGCA
ACAACATCAGCAACAGCCCCAGCAACAACACCAGCAACAGCACCAGCAACTGCACCAGCAACAACaCCCTCCACATTTTGGAGAGTTTCC
AAGGGGTCCACAACCTCTGCCAGGTCCACCACCCATGATGCGGCAGCCATCTGCATCCTCCACTACTCTTAACTCTCAGCTACCTGGACC
TCCTCCTCATCCTTCTTATGACGCTCATGCTGACAGTTTTGCTGCAAAGAGAATGAGAAAAATTGGCCAGAGAAGAGCAGTTGACTACAC
CAGTACAGTTGTAAGATATATGCAGATCCGCATGTGGCAGCGCGATTCAAGGGATAGGACAGTGTTACAACCGAGCCCAGCAGCAGCAGT
TGATATATTGCCAGCAGTTGCCTATTTGGATAATCCATCTACAAGTTTTGCTGCTAAATTTGTTCATACATCTCTAAATAAAAACCgTTG
TTCAATCAATTGTCTTGCGTGGAXCTCCTAGTGGGCGGCGCCTTGTTACTGGATCTCAAAGTGGTGAATTCACACTATGGAATGGGCAAT
CATTTAACTTTGAAATGATTCTTCAGGCTCATGATCAAGCAGTCAGGTCAATGGTATGGAGCCACAATGATAACTGGATGGTCACTGGTG
ATGACGGGGGCACAATAAAGTATTGGCAAAACAATATGAATAATGTCAAAGCCCATAAGAATGCACATAAAGAATCAATACGGGAATTGA
GCTTCTGTAGTACAGATTTAAAATTCTGCTCCTGCTCTGACGACACTACCGTTAAAATATGGGACTTCGCAAGGTGCCAAGAAGAGCGCT
CATTATCTGGCCACGGTTGGGATGTGAAGAGTGTTGATTGGCACCCTACAAAGTCTCTCTTAGTCTCAGGTGGAAAAGATAATCTTGTTA
AACTTTGGGATGCCAAGTCAGGAAAGGAGCTTTCATCATTTCATGGACATAAGAATACCGTTCTCTGTGTAAAGTGGAATCAAAATGGTA
ACTGGGTCCTTACTGCTTCCAAGGATCAAATTATCAAGCTTTATGACATACGTGCTATGAAGGAGGTTGAGTCATTCCGAGGGCATCAGA
AGGATGTGACATCACTGGCCTGGCATCCATTTCATGAAGAATATTTCGTCAGTGGAAGCTTTGATGGTTCAATATTTCATTGGCTTGTGG
GGCATGAAGCTCCTCAAGTAGAAATCACAAATGCACATGAAACTGGTGTTTGGGATCTTGCGTGGCACCCCATTGGCTATCTCCTTTGCA
GCGGTAGTAATGATCAGACAACAAAGTTCTGGTGCAGAAATAGGCCTGGGGACTCCGCTCGTGATAAATTCAATTTAGGACAACAAGGTT
TGGGTGATCAACACAATGTTCTTGGTCGCATGCCTGGTAATTTTCCAGGTCCTGAGCCCCCATCAACTCCTGGAGCATTTGCCTCTGGTA
TGTTACGAACGGAGGGTACAATACCTGGAGTTGGAGCTGCAATGCCACTGTCTATCCCGTCACTTGATTCACCTTCTCAAGGAGAACAGA
AGACTTCAATGCCTTTAGGAGCTCCTCCCCTTCCTCCTGGTCCACATCCATCGCTTCTTGCAAGTAATCAGCAGCAAGCATATCAACAAA
ACATGCAGCAAGCTCAGCAGCAGTCACTGCCTCAACAAATGACTTCTCTTCCTTTGCAACCACCGAATTTGCCACAGCTACAGCCTCCAC
ATATGCCTCTAATGCCACATCCTCATCTACCTCGGCCACCACATCAACTACAACCAGTAAACATGCCCGGCATTCAGTCTTCAATGCCAG
GATCTGGACCCATCCAAGGAATGCCTCCGATGGGGATACAAGGTAACATGAATCAGATGGGCCCTCCAATGCCTCAAGGTCATTTTGTTG
GCATGCCTCCTGGATCTGGACCGCAGGGCAATGTTCCCCCTGGTGGAATGCCAAATGGATTGCCAAACATGCAAGGCCCTCAAAATGCAG
GAGGCAATCAGATGTTTCCACCAGTACGAGGCTTCAACAGGCCACAAGCTGGACAGATGCCGCTCATGCCTGGACTTAATCCTTATCAGC
AATCTGGAAATCCAAACACACCTCCTGGAATGCACATGCAGTCAAACTTTGGTCATCAATCTGGAATGCCTCCGCCACTGCCGCCAGGGC
CTCCACCACATAATCAAGGACATCAATAG(3')GCCATTGTCTATAGTTTCGAGCTTTGCTCAAGTTGTCTGTTGAGATTCTACTCTCTG
CACCAGTTCAATTGGTTAATTGATTTCTTTTGACAGACAGTCGGATAGCATCTCTGTATTTTCTTGAATGTATTTTTAGGGAAAAGTTAT
TGCATATTTATGCATTCGGAGTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan