ESTScan Details for Unigene SGN-U576286

Score 
1707
Direction 
Forward
Predicted Peptide Sequence 
MKPVNPEDVHSAENVPKENQEETGSHKLTGHPVKVGPSEAKFCEPVLQDDIHIHRDKLKDTCTTNIMKPVNPEDVQPAKNMPKENQEETG
SHKLTGHPVKVGPSEAKFCEPVLQDDIHREKLKDTCTTNIMKPDNPEDVQPATNVPKENQEGTGSHELTDSSGHHSLVSENHNNSTGSHG
HLCQSKRKEIPINNDDELVVSIPIGDVPQSQVQKKDSLHLGERTKRTQCAKRKLGSDSKKNESASDCETERKSESGIKNEEGNLEEHKEP
TLQQIFGIKXVEEEDEETTNTEESRDKDSERARTSKDHGAELIGTKIKVWWPLEQAFYKGVIYSFDSETNKHKVVYDDGEVEKLRLHKER
WEMLEDNSSQKDSKRLCSIKDYGTELVGDRIKVWWPLDEKFYEGVISSFDFETNKHKVVYDDGEVEILRLYKQRWMMLEDNSSQKDFKRT
FTMKDYGKELVGARIKVWWPLDEKFYEGVVSSFDPVERKHKVVYNDGETEKLRLHKERWEMLEDNSTQKDHGLDFQVHAVSSATVIKQRR
VEGPESVEISVVNREENSTAGSVEEFS*
Predicted Coding Sequence 
ATGAAACCAGTCAATCCAGAAGATGTGCACTCAGCAGAAAATGTGCCAAAAGAAAACCAGGAAGAGACTGGAAGCCATAAACTTACAGGT
CATCCTGTAAAAGTTGGTCCATCCGAGGCTAAATTTTGTGAGCCAGTGCTGCAGGATGACATTCACATTCACAGGGACAAGCTAAAGGAT
ACTTGTACAACAAACATCATGAAACCTGTCAATCCAGAAGATGTGCAACCAGCAAAAAATATGCCAAAAGAAAACCAGGAAGAGACTGGA
AGCCATAAACTTACAGGTCATCCTGTAAAAGTTGGTCCATCCGAGGCTAAATTTTGTGAGCCAGTGCTGCAGGATGACATTCACAGGGAG
AAGCTAAAAGATACTTGTACAACAAACATAATGAAACCTGACAATCCAGAAGATGTGCAACCAGCAACAAATGTGCCAAAAGAAAACCAG
GAAGGGACTGGAAGTCATGAACTTACAGATAGTAGTGGCCATCATTCTTTGGTGTCTGAAAATCACAATAATAGCACTGGAAGTCATGGT
CATCTGTGTCAGTCCAAGAGAAAAGAGATCCCGATAAATAACGATGATGAGCTGGTTGTGTCAATTCCAATAGGAGATGTGCCACAATCC
CAAGTTCAGAAAAAAGATTCTCTTCATTTGGGAGAGAGAACCAAGCGCACACAGTGTGCCAAAAGAAAACTAGGAAGCGACTCAAAGAAG
AATGAGTCTGCTTCAGATTGTGAAACAGAGAGAAAATCTGAATCTGGCATAAAAAATGAAGAAGGAAACCTCGAAGAACACAAAGAGCCA
ACACTGCAACAAATTTTTGGAATCAAAXCTGTGGAAGAAGAAGACGAAGAAACAACTAATACTGAAGAATCTAGAGATAAGGATTCTGAA
AGGGCTCGTACCAGCAAAGATCATGGTGCAGAACTGATCGGCACTAAAATAAAAGTTTGGTGGCCATTGGAGCAAGCGTTTTACAAGGGA
GTCATTTATTCTTTTGATTCTGAGACAAACAAACACAAGGTCGTATATGATGATGGTGAAGTAGAGAAACTGAGACTTCATAAAGAACGA
TGGGAAATGCTTGAAGACAATTCATCTCAAAAGGATTCCAAAAGGCTTTGTTCCATCAAAGATTATGGTACGGAACTGGTTGGCGATAGA
ATAAAAGTTTGGTGGCCATTGGATGAAAAGTTTTACGAGGGAGTCATTTCTTCTTTTGATTTTGAGACAAACAAACACAAGGTCGTATAT
GATGATGGTGAAGTAGAGATTTTGAGACTATATAAACAACGTTGGATGATGCTTGAAGACAATTCATCTCAAAAGGATTTTAAAAGGACT
TTTACCATGAAAGATTATGGTAAGGAACTGGTTGGCGCTAGGATAAAAGTTTGGTGGCCATTGGATGAAAAGTTTTACGAGGGAGTAGTT
TCTTCTTTTGATCCTGTGGAAAGGAAACACAAGGTCGTATATAATGATGGTGAAACAGAGAAATTGAGGCTACATAAAGAACGATGGGAG
ATGCTTGAAGATAATTCAACTCAAAAGGACCATGGATTAGACTTTCAAGTCCATGCTGTTTCATCTGCTACXGTCATAAAGCAGCGTAGA
GTAGAAGGGCCTGAATCAGTGGAAATTTCTGTTGTGAATAGGGAAGAAAACTCAACTGCTGGAAGTGTTGAAGAATTTTCATAA
Edits in Original Sequence 
GCTAAATGTTGTGAGCTAGCGCGGCAGGATGACACTCACAGGGAGAAGCGAAAGGATACTTGTCTACCTAACATC(5')ATGAAACCAGT
CAATCCAGAAGATGTGCACTCAGCAGAAAATGTGCCAAAAGAAAACCAGGAAGAGACTGGAAGCCATAAACTTACAGGTCATCCTGTAAA
AGTTGGTCCATCCGAGGCTAAATTTTGTGAGCCAGTGCTGCAGGATGACATTCACATTCACAGGGACAAGCTAAAGGATACTTGTACAAC
AAACATCATGAAACCTGTCAATCCAGAAGATGTGCAACCAGCAAAAAATATGCCAAAAGAAAACCAGGAAGAGACTGGAAGCCATAAACT
TACAGGTCATCCTGTAAAAGTTGGTCCATCCGAGGCTAAATTTTGTGAGCCAGTGCTGCAGGATGACATTCACAGGGAGAAGCTAAAAGA
TACTTGTACAACAAACATAATGAAACCTGACAATCCAGAAGATGTGCAACCAGCAACAAATGTGCCAAAAGAAAACCAGGAAGGGACTGG
AAGTCATGAACTTACAGATAGTAGTGGCCATCATTCTTTGGTGTCTGAAAATCACAATAATAGCACTGGAAGTCATGGTCATCTGTGTCA
GTCCAAGAGAAAAGAGATCCCGATAAATAACGATGATGAGCTGGTTGTGTCAATTCCAATAGGAGATGTGCCACAATCCCAAGTTCAGAA
AAAAGATTCTCTTCATTTGGGAGAGAGAACCAAGCGCACACAGTGTGCCAAAAGAAAACTAGGAAGCGACTCAAAGAAGAATGAGTCTGC
TTCAGATTGTGAAACAGAGAGAAAATCTGAATCTGGCATAAAAAATGAAGAAGGAAACCTCGAAGAACACAAAGAGCCAACACTGCAACA
AATTTTTGGAATCAAAXCTGTGGAAGAAGAAGACGAAGAAACAACTAATACTGAAGAATCTAGAGATAAGGATTCTGAAAGGGCTCGTAC
CAGCAAAGATCATGGTGCAGAACTGATCGGCACTAAAATAAAAGTTTGGTGGCCATTGGAGCAAGCGTTTTACAAGGGAGTCATTTATTC
TTTTGATTCTGAGACAAACAAACACAAGGTCGTATATGATGATGGTGAAGTAGAGAAACTGAGACTTCATAAAGAACGATGGGAAATGCT
TGAAGACAATTCATCTCAAAAGGATTCCAAAAGGCTTTGTTCCATCAAAGATTATGGTACGGAACTGGTTGGCGATAGAATAAAAGTTTG
GTGGCCATTGGATGAAAAGTTTTACGAGGGAGTCATTTCTTCTTTTGATTTTGAGACAAACAAACACAAGGTCGTATATGATGATGGTGA
AGTAGAGATTTTGAGACTATATAAACAACGTTGGATGATGCTTGAAGACAATTCATCTCAAAAGGATTTTAAAAGGACTTTTACCATGAA
AGATTATGGTAAGGAACTGGTTGGCGCTAGGATAAAAGTTTGGTGGCCATTGGATGAAAAGTTTTACGAGGGAGTAGTTTCTTCTTTTGA
TCCTGTGGAAAGGAAACACAAGGTCGTATATAATGATGGTGAAACAGAGAAATTGAGGCTACATAAAGAACGATGGGAGATGCTTGAAGA
TAATTCAACTCAAAAGGACCATGGATTAGACTTTCAAGTCCATGCTGTTTCATCTGCTACXGTCATAAAGCAGCGTAGAGTAGAAGGGCC
TGAATCAGTGGAAATTTCTGTTGTGAATAGGGAAGAAAACTCAACTGCTGGAAGTGTTGAAGAATTTTCATAA(3')AGCAGTGTGATGT
AAGTGTAACTACTAAATTAGGTTTACCATTAAGGGATGTGATCCAATTGATTGGAGAAATGAGATTCTAGTCTTAGAAAAAAAGAACTGA
GCTTGTAGATTTATTGTATGTAGCTACAGGCTGCTCTTGGTGTTTACAGATACTTGGCGTCTTATATGTATATATATGATTAAATT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan