ESTScan Details for Unigene SGN-U576494

Score 
760
Direction 
Forward
Predicted Peptide Sequence 
AEMWGHWADNXMVGKPLFSNQMKAETIWWYLTISMALRVVSSSPAIFSSQRRAASVLPSTLTLPNTNSSLLSSSSPISSIDRTKSVVTLR
SKTSRRSGVVTCSASVLPKALLFDCDGVLVDTEKDGHRISFNDTFSEKELGVTWDVDLYGELLKIGGGKERMTAYFNKVGWPENAPKTEE
ERKEFIAGLHKRKTELFMVLIEKKLLPLRPGVEKLIDQALGNGVKVAVCSTSNEKAVSAIVSCLLGPERAEQIQIFAGDVVPRKKPDPAI
YLLAAGTLAVDPSSCVVVEDSGIGLAAAKAAGMTCIVTKSGYTAEENFSNADAVFDCIGDPPEERFDLAFCGSLLEKQYVS*
Predicted Coding Sequence 
GCGGAGATGTGGGGTCATTGGGCGGATAACXGCATGGTTGGAAAACCGTTATTTTCCAACCAAATGAAAGCTGAAACAATTTGGTGGTAC
CTAACGATTTCAATGGCGTTGAGAGTTGTCTCTTCTTCTCCGGCCATTTTTTCATCACAAAGAAGAGCTGCTTCAGTTCTACCATCAACA
CTCACATTACCCAATACCAACAGCTCCCTGTTATCGTCATCATCACCCATTTCTTCAATTGACAGAACAAAATCAGTTGTTACTCTCCGT
AGCAAGACGAGTAGGCGTAGTGGAGTAGTGACATGTTCTGCTTCGGTCCTCCCAAAGGCACTGCTATTCGACTGCGATGGCGTACTTGTC
GATACTGAAAAAGATGGTCATCGTATTTCTTTCAATGATACCTTTTCTGAGAAGGAATTGGGTGTAACTTGGGATGTTGATTTGTATGGA
GAATTACTCAAAATTGGAGGTGGAAAAGAAAGGATGACAGCCTACTTTAACAAAGTAGGTTGGCCAGAAAATGCACCAAAAACTGAAGAA
GAAAGAAAGGAGTTTATTGCAGGACTTCACAAGCGAAAGACCGAATTATTCATGGTTCTCATTGAGAAGAAATTGCTACCACTTCGGCCA
GGTGTTGAAAAGTTGATTGATCAGGCTCTGGGTAATGGAGTTAAAGTTGCAGTATGCAGCACTTCCAATGAAAAGGCGGTCTCAGCCATA
GTCTCGTGCTTGTTGGGACCAGAGCGAGCAGAACAGATCCAGATATTTGCAGGTGATGTGGTTCCTCGAAAGAAGCCTGATCCGGCCATT
TATCTGTTAGCAGCCGGAACCCTTGCGGTTGATCCTTCAAGTTGTGTTGTCGTAGAAGATAGTGGCATAGGTCTTGCAGCTGCCAAAGCA
GCTGGAATGACGTGCATTGTGACCAAGAGTGGGTACACAGCAGAAGAGAATTTCTCAAATGCAGATGCAGTTTTTGATTGCATTGGAGAT
CCTCCCGAGGAACGGTTTGACTTGGCATTTTGCGGAAGCCTTCTTGAGAAACAATATGTGAGTTAG
Edits in Original Sequence 
(5')GCGGAGATGTGGGGTCATTGGGCGGATAACXGCATGGTTGGAAAACCGTTATTTTCCAACCAAATGAAAGCTGAAACAATTTGaGT
GGTACCTAACGATTTCAATGGCGTTGAGAGTTGTCTCTTCTTCTCCGGCCATTTTTTCATCACAAAGAAGAGCTGCTTCAGTTCTACCAT
CAACACTCACATTACCCAATACCAACAGCTCCCTGTTATCGTCATCATCACCCATTTCTTCAATTGACAGAACAAAATCAGTTGTTACTC
TCCGTAGCAAGACGAGTAGGCGTAGTGGAGTAGTGACATGTTCTGCTTCGGTCCTCCCAAAGGCACTGCTATTCGACTGCGATGGCGTAC
TTGTCGATACTGAAAAAGATGGTCATCGTATTTCTTTCAATGATACCTTTTCTGAGAAGGAATTGGGTGTAACTTGGGATGTTGATTTGT
ATGGAGAATTACTCAAAATTGGAGGTGGAAAAGAAAGGATGACAGCCTACTTTAACAAAGTAGGTTGGCCAGAAAATGCACCAAAAACTG
AAGAAGAAAGAAAGGAGTTTATTGCAGGACTTCACAAGCGAAAGACCGAATTATTCATGGTTCTCATTGAGAAGAAATTGCTACCACTTC
GGCCAGGTGTTGAAAAGTTGATTGATCAGGCTCTGGGTAATGGAGTTAAAGTTGCAGTATGCAGCACTTCCAATGAAAAGGCGGTCTCAG
CCATAGTCTCGTGCTTGTTGGGACCAGAGCGAGCAGAACAGATCCAGATATTTGCAGGTGATGTGGTTCCTCGAAAGAAGCCTGATCCGG
CCATTTATCTGTTAGCAGCCGGAACCCTTGCGGTTGATCCTTCAAGTTGTGTTGTCGTAGAAGATAGTGGCATAGGTCTTGCAGCTGCCA
AAGCAGCTGGAATGACGTGCATTGTGACCAAGAGTGGGTACACAGCAGAAGAGAATTTCTCAAATGCAGATGCAGTTTTTGATTGCATTG
GAGATCCTCCCGAGGAACGGTTTGACTTGGCATTTTGCGGAAGCCTTCTTGAGAAACAATATGTGAGTTAG(3')TGCATAAGGGCGCTT
GTTTATTGGCATGTTTTGCTAACCACATATCAGTTCATGTACTGTATCTCCCCAATGACTGTTCAATAAAAAGTCTAATGTCATTTCATC
TCTTGATGCCTTCTCTGTTAGTCTCCAAACACAATATATGAACTTCCAGTTTTCCTTTTCTTTTGTAGAGTGTGGAGAGGAGGTGATAGA
AATGATAAAATTACTATTTGCATAGCATAAAGACACAACTTACAAATTAATAAACATAATTTGAGGATATAGTAACCAAAACATAATTTG
AGGACATTAGTACTATGTTGGATTTTTTTCCTTTNNAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan