ESTScan Details for Unigene SGN-U576495

Score 
997
Direction 
Forward
Predicted Peptide Sequence 
QLIDVQRNLIESFTQRPGYPFQIMLAGNPFCNEGGDGTQDYCVKTQQTETYSTPPENCLPTDCSSNRVSSPTCKCAFPYTGNIVFRAPSF
SNLGNRTTYETLQKSLMQTFQNRQLPVESVALSNPTKNLDDYLVIHLQVFPSTQDFFNRTGVSGIGSVLSNQTFKPPSSFGPFFFIGEGY
KYFDGASSESKNSSSTGIIIGAAVGGSVIAIIALIIGVYAFRQKKRAEDAAKRSDPFASWDSNKHSGAVPQLTGARFFSFEELKKWTNNF
SETNDIGCGGYGKVYRGTLPNGELVAIKRALQGSMQGAHEFKTEIELLSRVHHKNVVGLAGFCFDQAEQMLVYEYIPNGTLKDGLSGKTG
IRLDWMRRLRIAVGAARGLQYLHDLVNPPIIHRX
Predicted Coding Sequence 
CAGCTCATTGATGTGCAAAGAAATCTTATTGAATCATTTACTCAAAGACCAGGGTACCCCTTTCAGATAATGCTTGCAGGTAATCCTTTT
TGCAACGAAGGAGGAGATGGGACACAAGATTACTGTGTCAAAACTCAACAAACTGAGACATATTCAACCCCACCAGAGAATTGCTTGCCA
ACTGACTGCAGCTCTAATCGAGTTTCTAGTCCTACCTGTAAATGTGCTTTTCCATATACAGGAAACATAGTCTTCAGAGCTCCTTCCTTT
TCAAACTTGGGAAATAGAACTACTTATGAGACTCTCCAAAAGTCCTTGATGCAAACCTTTCAAAACCGTCAACTGCCCGTGGAATCAGTG
GCCCTCAGTAACCCAACAAAAAATTTGGATGACTACCTTGTAATACACCTGCAAGTTTTTCCATCTACCCAAGATTTTTTCAATCGAACT
GGAGTTTCTGGAATAGGTTCTGTGCTTAGTAATCAGACTTTCAAGCCCCCATCATCATTTGGACCTTTCTTCTTCATTGGTGAAGGCTAT
AAATACTTTGACGGGGCATCCTCCGAATCAAAAAACTCAAGCAGTACAGGCATTATTATTGGAGCGGCAGTTGGTGGCTCTGTCATTGCA
ATTATAGCACTAATCATTGGAGTTTATGCTTTCCGGCAAAAGAAAAGAGCTGAAGATGCTGCAAAGAGGAGCGATCCTTTTGCATCCTGG
GACTCGAACAAACATAGTGGTGCTGTACCACAGCTGACGGGAGCTAGATTTTTCTCATTTGAGGAGCTCAAAAAATGGACCAATAATTTT
TCAGAAACCAATGATATTGGTTGTGGTGGTTATGGAAAGGTTTACAGAGGAACTCTTCCAAATGGAGAATTGGTTGCAATTAAAAGAGCT
CTACAAGGGTCTATGCAGGGTGCACACGAGTTCAAAACTGAGATAGAGCTTCTCTCAAGGGTTCATCACAAGAACGTCGTTGGCCTTGCT
GGCTTTTGTTTCGATCAAGCTGAACAGATGCTTGTGTACGAGTACATTCCTAATGGCACCTTAAAAGACGGTCTTTCAGGCAAGACTGGC
ATCAGGTTAGATTGGATGAGGAGACTGAGGATAGCCGTTGGAGCAGCCAGAGGTTTGCAGTATTTGCATGACCTTGTCAATCCTCCCATC
ATACACAGGGAX
Edits in Original Sequence 
(5')CAGCTCATTGATGTGCAAAGAAATCTTATTGAATCATTTACTCAAAGACCAGGGTACCCCTTTCAGATAATGCTTGCAGGTAATCC
TTTTTGCAACGAAGGAGGAGATGGGACACAAGATTACTGTGTCAAAACTCAACAAACTGAGACATATTCAACCCCACCAGAGAATTGCTT
GCCAACTGACTGCAGCTCTAATCGAGTTTCTAGTCCTACCTGTAAATGTGCTTTTCCATATACAGGAAACATAGTCTTCAGAGCTCCTTC
CTTTTCAAACTTGGGAAATAGAACTACTTATGAGACTCTCCAAAAGTCCTTGATGCAAACCTTTCAAAACCGTCAACTGCCCGTGGAATC
AGTGGCCCTCAGTAACCCAACAAAAAATTTGGATGACTACCTTGTAATACACCTGCAAGTTTTTCCATCTACCCAAGATTTTTTCAATCG
AACTGGAGTTTCTGGAATAGGTTCTGTGCTTAGTAATCAGACTTTCAAGCCCCCATCATCATTTGGACCTTTCTTCTTCATTGGTGAAGG
CTATAAATACTTTGACGGGGCATCCTCCGAATCAAAAAACTCAAGCAGTACAGGCATTATTATTGGAGCGGCAGTTGGTGGCTCTGTCAT
TGCAATTATAGCACTAATCATTGGAGTTTATGCTTTCCGGCAAAAGAAAAGAGCTGAAGATGCTGCAAAGAGGAGCGATCCTTTTGCATC
CTGGGACTCGAACAAACATAGTGGTGCTGTACCACAGCTGACGGGAGCTAGATTTTTCTCATTTGAGGAGCTCAAAAAATGGACCAATAA
TTTTTCAGAAACCAATGATATTGGTTGTGGTGGTTATGGAAAGGTTTACAGAGGAACTCTTCCAAATGGAGAATTGGTTGCAATTAAAAG
AGCTCTACAAGGGTCTATGCAGGGTGCACACGAGTTCAAAACTGAGATAGAGCTTCTCTCAAGGGTTCATCACAAGAACGTCGTTGGCCT
TGCTGGCTTTTGTTTCGATCAAGCTGAACAGATGCTTGTGTACGAGTACATTCCTAATGGCACCTTAAAAGACGGTCTTTCAGGCAAGAC
TGGCATCAGGTTAGATTGGATGAGGAGACTGAGGATAGCCGTTGGAGCAGCCAGAGGTTTGCAGTATTTGCATGACCTTGTCAATCCTCC
CATCATACACAGGGAX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan