ESTScan Details for Unigene SGN-U576509

Score 
1662
Direction 
Forward
Predicted Peptide Sequence 
XSPKGINTWEMAVSAVTYSNADRDKDFYKNVFVIDEDSPSSNSSSSPPNNSNNNSPPKKDNSSSSNGNDNGNNNSSNNNNNNNNNNNNSN
SQSPPSNNDSSSGKDNNSSSSNNNNNNNNSNNNNNNNNSNSQSPPSNNNNSSSGKDNNSSSNNNNNGNNNNGNNNNNGNNNNGNNNNDNN
NNGNNNDNDDDNNNNNDNKSRSPPNSSKGGSSLPPPVSPPSHFSPNSRPLAPPKPQSDKSDSNDNKTALRIGVAAGAGLLFIVMLVFLIS
CCKRKKKRKHDQMGYYRDNSHGAMNNHYYNNTGQRTNNWQSNNKLQSTDQFHNMPPPGSGQVSSEHSWPIAPPPPPPMMSSSEMSSSAFS
GPHQPAQPPPHPAMALGYNQSSFTYDDLAVATGGFTKDKLLGQGGFGYVHKGVLPNGKEIAVKSLKSNSGQGEREFQAEVEIIVVYIIDI
LCLWLDNALLDLKGCWSMN
Predicted Coding Sequence 
XTTTCTCCTAAAGGAATCAATACTTGGGAGATGGCGGTATCTGCXGTAACATATTCTAACGCAGATCGTGACAAAGACTTTTATAAAAAT
GTCTTCGTCATCGACGAGGACTCTCCATCATCAAATTCATCATCATCTCCACCAAATAATTCAAATAACAATTCACCACCCAAAAAAGAT
AATAGCTCTTCTTCTAATGGTAATGATAATGGTAATAATAATAGTAGTAATAATAATAATAATAACAACAACAATAACAATAATTCAAAC
TCTCAATCTCCACCTTCTAACAACGATTCATCCTCTGGAAAAGATAATAACTCCTCTTCTTCAAATAACAATAACAACAACAACAATAGT
AACAACAACAATAACAATAATAATTCAAACTCTCAATCTCCTCCTTCTAATAACAATAATTCGTCATCCGGAAAAGATAACAACTCTTCT
TCGAATAATAACAACAATGGTAACAACAATAATGGTAATAACAACAATAATGGTAATAACAACAATGGTAACAACAATAATGATAATAAC
AACAATGGTAACAACAATGATAATGACGATGACAATAACAATAACAACGATAACAAGTCACGTTCTCCACCAAACTCATCAAAAGGAGGA
TCATCGCTGCCTCCTCCAGTTTCTCCACCATCACATTTTTCTCCAAACTCGAGACCTCTTGCCCCTCCAAAGCCTCAATCAGATAAGTCA
GACAGTAACGATAACAAAACAGCACTCAGGATCGGAGTCGCAGCTGGAGCAGGATTATTATTTATTGTCATGCTAGTTTTCCTCATCTCT
TGTTGTAAGCGGAAAAAGAAAAGAAAGCATGATCAAATGGGCTACTACAGAGACAATTCTCATGGAGCCATGAATAATCATTACTATAAC
AACACTGGACAACGTACCAACAATTGGCAGAGTAACAACAAACTTCAATCAACTGACCAATTTCACAATATGCCTCCTCCAGGGAGTGGT
CAAGTAAGTTCAGAGCATAGTTGGCCAATAGCACCACCACCACCACCACCGATGATGAGTAGTAGTGAAATGAGCTCGTCGGCATTCTCT
GGTCCACATCAACCTGCTCAACCACCTCCACATCCAGCAATGGCTCTTGGTTATAATCAAAGTAGTTTCACTTATGATGACCTAGCAGTT
GCAACTGGAGGATTTACTAAAGACAAATTATTGGGACAAGGTGGTTTTGGATATGTACATAAAGGAGTGTTGCCTAATGGTAAAGAAATT
GCTGTGAAAAGTTTGAAATCTAATAGTGGACAAGGAGAAAGAGAGTTTCAAGCAGAAGTTGAAATTATTGTCGTGTACATCATCGACATC
TTGTGTCTTTGGTTGGATAATGCATTGCTGGATCTCAAAGGATGTTGGTCTATGAAT
Edits in Original Sequence 
(5')XTTTCTCCTAAAGGAATCAATACTTGGGAGATcGGCGGTATCTGCXGTAACATATTCTAACGCAGATCGTGACAAAGACTTTTATA
AAAATGTCTTCGTCATCGaACGAGGACTCTCCATCATCAAATTCATCATCATCTCCACCAAATAATTCAAATAACAATTCACCACCCAAA
AAAGATAATAGCTCTTCTTCTAATGGTAATGATAATGGTAATAATAATAGTAGTAATAATAATAATAATAACAACAACAATAACAATAAT
TCAAACTCTCAATCTCCACCTTCTAACAACGATTCATCCTCTGGAAAAGATAATAACTCCTCTTCTTCAAATAACAATAACAACAACAAC
AATAGTAACAACAACAATAACAATAATAATTCAAACTCTCAATCTCCTCCTTCTAATAACAATAATTCGTCATCCGGAAAAGATAACAAC
TCTTCTTCGAATAATAACAACAATGGTAACAACAATAATGGTAATAACAACAATAATGGTAATAACAACAATGGTAACAACAATAATGAT
AATAACAACAATGGTAACAACAATGATAATGACGATGACAATAACAATAACAACGATAACAAGTCACGTTCTCCACCAAACTCATCAAAA
GGAGGATCATCGCTGCCTCCTCCAGTTTCTCCACCATCACATTTTTCTCCAAACTCGAGACCTCTTGCCCCTCCAAAGCCTCAATCAGAT
AAGTCAGACAGTAACGATAACAAAACAGCACTCAGGATCGGAGTCGCAGCTGGAGCAGGATTATTATTTATTGTCATGCTAGTTTTCCTC
ATCTCTTGTTGTAAGCGGAAAAAGAAAAGAAAGCATGATCAAATGGGCTACTACAGAGACAATTCTCATGGAGCCATGAATAATCATTAC
TATAACAACACTGGACAACGTACCAACAATTGGCAGAGTAACAACAAACTTCAATCAACTGACCAATTTCACAATATGCCTCCTCCAGGG
AGTGGTCAAGTAAGTTCAGAGCATAGTTGGCCAATAGCACCACCACCACCACCACCGATGATGAGTAGTAGTGAAATGAGCTCGTCGGCA
TTCTCTGGTCCACATCAACCTGCTCAACCACCTCCACATCCAGCAATGGCTCTTGGTTATAATCAAAGTAGTTTCACTTATGATGACCTA
GCAGTTGCAACTGGAGGATTTACTAAAGACAAATTATTGGGACAAGGTGGTTTTGGATATGTACATAAAGGAGTGTTGCCTAATGGTAAA
GAAATTGCTGTGAAAAGTTTGAAATCTAATAGTGGACAAGGAGAAAGAGAGTTTCAAGCAGAAGTTGAAATTATTaGTCGTGTACATCAT
CGACATCTTGTGTCTTTGGTTGGATAATGCATTGCTGGATCTCAAAGGATGTTGGTCTATGAAT(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan