ESTScan Details for Unigene SGN-U576773

Score 
1027
Direction 
Forward
Predicted Peptide Sequence 
XQVVPRQFMDLGLAAGAGGTASEAEEASLSSSEGPSGREKSRSPVNNIESSSTCGIVREDSPEKVSPGWGPNKIPRLGNTSTNNKPADQA
TEATMRKARVSVRARSEAPMITDGCQWRKYGQKMAKGNPCPRAYYRCTMAAGCPVRKQVQRCAEDRTILITTYEGTHNHPLPPAAIADGL
DNFLSSENVALGLYANADGLMNSNFFARTLLPCSSSMATISASAPFPTVTLDLTQSPNPLQFPRPPNQFQIPFSNPPHNNILANPAALLP
QIFGQALYNQSKFSGLQSSQDLEGQQHPSTMPSSINPSNHNPVADTVNALTSDPNFTAALAAAITSLIGNPGQPNNGTNNTIATTTTPAN
NNNNSVTSNGNNNNNGSNNKVTNSSFPAN*
Predicted Coding Sequence 
XGACAAGTAGTGCCTAGGCAATTTATGGATCTTGGCTTAGCTGCTGGTGCTGGTGGTACTGCTTCTGAAGCGGAAGAGGCTTCCCTGTCT
TCGTCAGAGGGGCCAAGTGGCAGGGAAAAATCGCGATCACCAGTGAATAACATTGAATCTAGTTCCACATGTGGGATTGTAAGAGAAGAT
AGTCCTGAAAAAGTGTCACCTGGTTGGGGTCCTAATAAAATTCCAAGACTTGGTAATACCTCTACTAATAATAAACCTGCTGATCAAGCT
ACTGAGGCTACTATGAGAAAGGCTCGGGTCTCGGTCAGGGCTCGATCAGAAGCTCCCATGATCACAGATGGCTGTCAATGGCGAAAGTAT
GGGCAGAAAATGGCTAAGGGAAACCCGTGCCCTCGAGCTTATTACCGGTGCACCATGGCAGCTGGTTGTCCAGTTCGGAAGCAAGTTCAA
AGATGTGCAGAGGACAGAACAATCTTGATCACAACTTATGAAGGTACTCACAACCATCCGTTGCCTCCGGCAGCCATAGCXGATGGCCTC
GACAACTTCCTCAGCAGCGAAAATGTTGCTCTCGGGCTCTATGCCAATGCAGATGGGCTAATGAATTCCAATTTCTTCGCGAGAACTCTC
CTTCCTTGCTCTTCCAGCATGGCCACAATTTCAGCCTCGGCCCCGTTCCCTACTGTTACATTGGACCTAACTCAATCCCCGAACCCGTTG
CAATTCCCAAGACCCCCTAACCAATTCCAAATCCCATTTTCAAATCCACCTCACAACAACATCCTAGCAAATCCAGCTGCACTTTTGCCT
CAGATATTTGGACAGGCTTTGTATAACCAATCCAAATTCTCTGGCCTCCAATCATCTCAAGATTTAGAAGGACAACAACACCCTTCAACG
ATGCCATCCTCGATTAATCCATCCAACCACAATCCTGTAGCTGACACGGTGAACGCCTTAACCAGTGATCCTAATTTCACCGCAGCATTA
GCAGCAGCCATCACTTCACTTATTGGCAATCCGGGGCAACCAAACAATGGTACCAACAACACCATCGCCACCACCACAACGCCAGCCAAC
AACAATAACAACAGTGTCACAAGCAATGGCAATAACAACAACAATGGCAGCAACAATAAAGTGACGAATTCGAGTTTTCCAGCAAACTGA
Edits in Original Sequence 
(5')XGACAAGTAGTGCCTAGGCAATTTATGGATCTTGGCTTAGCTGCTGGTGCTGGTGGTACTGCTTCTGAAGCGGAAGAGGCTTCCCT
GTCTTCGTCAGAGGGGCCAAGTGGCAGGGAAAAATCGCGATCACCAGTGAATAACATTGAATCTAGTTCCACATGTGGGATTGTAAGAGA
AGATAGTCCTGAAAAAGTGTCACCTGGTTGGGGTCCTAATAAAATTCCAAGACTTGGTAATACCTCTACTAATAATAAACCTGCTGATCA
AGCTACTGAGGCTACTATGAGAAAGGCTCGGGTCTCGGTCAGGGCTCGATCAGAAGCTCCCATGATCACAGATGGCTGTCAATGGCGAAA
GTATGGGCAGAAAATGGCTAAGGGAAACCCGTGCCCTCGAGCTTATTACCGGTGCACCATGGCAGCTGGTTGTCCAGTTCGGAAGCAAGT
TCAAAGATGTGCAGAGGACAGAACAATCTTGATCACAACTTATGAAGGTACTCACAACCATCCGTTGCCTCCGGCAGCCATAGCXGATGG
CCTCGACAACTTCCTCAGCAGCGAAAATGTTGCTCTCGGGCTCTATGCCAAgTGCAGATGGGCTAATGAATTCCAATTTCTTCGCGAGAA
CTCTCCTTCCTTGCTCTTCCAGCATGGCCACAATTTCAGCCTCGGCCCCGTTCCCTACTGTTACATTGGACCTAACTCAATCCCCGAACC
CGTTGCAATTCCCAAGACCCCCTAACCAATTCCAAATCCCATTTTCAAATCCACCTCACAACAACATCCTAGCAAATCCAGCTGCACTTT
TGCCTCAGATATTTGGACAGGCTTTGTATAACCAATCCAAATTCTCTGGCCTCCAATCATCTCAAGATTTAGAAGGACAACAACACCCTT
CAACGATGCCATCCTCGATTAATCCATCCAACCACAATCCTGTAGCTGACACGGTGAACGCCTTAACCAGTGATCCTAATTTCACCGCAG
CATTAGCAGCAGCCATCACTTCACTTATTGGCAATCCGGGGCAACCAAACAATGGTACCAACAACACCATCGCCACCACCACAACGCCAG
CCAACAACAATAACAACAGTGTCACAAGCAATGGCAATAACAACAACAATGGCAGCAACAATAAAGTGACGAATTCGAGTTTTCCAGCAA
ACTGA(3')TTGATAGCTTGTCAATTAAACTGCTGCGCGCATATTTTCCTTTCAAGAAAGAAATTTTTTTCTTAAATTAATTTTTTTGCT
TAACTAGTAATCAGGAAAACTAGATTACTATACAAGTTGATAAGATTCTTTTTGTGTGTTTTATACGTGGCTTAAAACATATAATCTTCC
ATTCTTTTTGTGGCTGAATAATGTAATTCAAGATTTCTTATCAATACAAGAAAATATATTGGCAAAGGAAAAGTACAGAAATGTTCTTCC
TTCT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan