ESTScan Details for Unigene SGN-U577148

Score 
574
Direction 
Forward
Predicted Peptide Sequence 
XYLALCGGKGANLGRQKRRPATSEIGDGSLGQLPIWASKPCIMGIDEAGRGPVLGPXGVWMPVLCTPYQKTLSTLQFADSKTLKEEKREE
LFEELKTNESIGWAVDVIDPRDLSAKMLKKNKINLNEISHNSAIGLVRKTLELGVLLTEVYVDTVGDPEKYRVKLSEIFPAIKFVVAKKA
DSLYPVVSGASIVAKVTRDRALRDWVLDETAENMQRNFGSGYPGDPETKAWLDNHKHAVFGFPTLVRFSWGTCNAYSTDNVEVVWESDAN
DEDEPNGRASKRQVKLTSIGFTGVKRKSEDIESNGKGRCKFFQARKLELLSQF*
Predicted Coding Sequence 
XGGTATTTAGCACTTTGTGGCGGGAAGGGAGCAAATCTCGGTAGACAGAAGCGGCGGCCGGCTACATCGGAGATCGGAGATGGTAGTTTG
GGGCAGCTTCCAATTTGGGCATCGAAGCCTTGTATCATGGGTATTGACGAAGCTGGTCGCGGTCCTGTTTTAGGGCCAAXTGGTGTATGG
ATGCCTGTATTGTGCACGCCATACCAGAAGACTCTTTCCACTTTACAGTTTGCAGACTCGAAGACTTTGAAAGAAGAGAAGAGGGAAGAA
CTATTCGAGGAATTAAAGACAAATGAATCCATCGGATGGGCTGTTGATGTGATAGATCCTAGAGATCTCTCAGCCAAAATGTTAAAGAAA
AATAAAATAAATCTTAATGAAATATCTCATAATTCTGCAATCGGCCTTGTGAGGAAGACACTGGAGCTTGGTGTTCTTTTAACTGAGGTT
TATGTGGATACTGTTGGTGATCCTGAAAAGTATAGAGTGAAGCTATCTGAAATTTTTCCAGCAATCAAATTTGTTGTTGCAAAAAAAGCT
GACAGTCTTTACCCCGTCGTAAGTGGAGCCAGTATTGTTGCAAAGGTTACTAGGGACCGAGCCTTGCGGGATTGGGTGCTTGATGAAACT
GCTGAGAACATGCAAAGGAACTTCGGATCTGGATATCCTGGAGATCCTGAGACAAAAGCTTGGCTAGATAATCACAAACACGCAGTTTTT
GGGTTCCCAACCTTGGTCCGTTTCAGCTGGGGAACATGTAACGCATACTCCACGGACAATGTCGAAGTAGTATGGGAATCTGATGCCAAT
GACGAAGATGAACCCAACGGAAGAGCTAGTAAGCGACAAGTGAAGCTAACTAGTATTGGTTTCACAGGTGTAAAACGGAAAAGTGAAGAT
ATCGAGTCAAATGGGAAAGGCCGTTGCAAATTCTTCCAAGCTCGTAAACTTGAGCTCCTCTCACAGTTCTGA
Edits in Original Sequence 
(5')XGGTATTTAGCACTTTGTGGCGGGAAGGGAGCAAATCgTCGGTAGACAGAAGCGGCGGCCGGCTACATCGGAGATCGGAGATgGGT
AGTTTGGGGCAGCTTCCAATTTGGGCATCGAAGCCTTGTATCATGGGTATTGACGAAGCTGGTCGCGGTCCTGTTTTAGGGCCAAXTGGT
GTATGGATGCCTGTATTGTGCACGCtCATACCAGAAGACTCTTTCCACTTTACAGTTTGCAGACTCGAAGACTTTGAAAGAAGAGAAGAG
GGAAGAACTATTCGAGGAATTAAAGACAAATGAATCCATCGGATGGGCTGTTGATGTGATAGATCCTAGAGATCTCTCAGCCAAAATGTT
AAAGAAAAATAAAATAAATCTTAATGAAATATCTCATAATTCTGCAATCGGCCTTGTGAGGAAGACACTGGAGCTTGGTGTTCTTTTAAC
TGAGGTTTATGTGGATACTGTTGGTGATCCTGAAAAGTATAGAGTGAAGCTATCTGAAATTTTTCCAGCAATCAAATTTGTTGTTGCAAA
AAAAGCTGACAGTCTTTACCCCGTCGTAAGTGGAGCCAGTATTGTTGCAAAGGTTACTAGGGACCGAGCCTTGCGGGATTGGGTGCTTGA
TGAAACTGCTGAGAACATGCAAAGGAACTTCGGATCTGGATATCCTGGAGATCCTGAGACAAAAGCTTGGCTAGATAATCACAAACACGC
AGTTTTTGGGTTCCCAACCTTGGTCCGTTTCAGCTGGGGAACATGTAACGCATACTCCACGGACAATGTCGAAGTAGTATGGGAATCTGA
TGCCAATGACGAAGATGAACCCAACGGAAGAGCTAGTAAGCGACAAGTGAAGCTAACTAGTATTGGTTTCACAGGTGTAAAACGGAAAAG
TGAAGATATCGAGTCAAATGGGAAAGGCCGTTGCAAATTCTTCCAAGCTCGTAAACTTGAGCTCCTCTCACAGTTCTGA(3')AGTACAC
AAATTCTCATTTACTGATAGAATGTGAAATGTTGCTTCAACACCAAATTCATCTGCCATTAACTAGAACAAGATGGTGATCGTAACGCGA
TTTGTATGATAACATCTTTTAAGGATTATCCATCATGTAGTCACTGAAATTATGTGTATCAATAATCATTAGTATCTGATGTATCTTCCT
ACATTACCTCTAGATTTATAACTCCTCGGATGCAAAGAGATAGTTTCACCTGATTGAAGAATTCAGTTTTATGTTATGCATTTAAATATC
T

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan