ESTScan Details for Unigene SGN-U577167

Score 
354
Direction 
Forward
Predicted Peptide Sequence 
MVRGKVEXEKNRKFNEQASDVFEKTKWTYKKAYELSVLCDAEVAFIIFSHKGRLYEFASSNMQKIIERYRGRARETTTVDKSTELEHYME
NLKHETANMAKKIEILEISKRKLMGQGLGSCSMDELEDIDSQLERTLKIIRARKTQLFKEEIESXKSKGETIAPTKCKXYVKSAGLRPMQ
SESAPAPAPEPIPAPPSTPPAQSKERGNCSQSTKSWEVETELFIAFLKRAAYSSLDQWLSQVFFFYQRNSNLEEVHREGKIGFNLYSIYT
TLKDXILTIYVIMLFFAVGESVKQPHQSYVAPPRPGQW
Predicted Coding Sequence 
ATGGTGAGAGGAAAAGTAGAAAXTGAAAAGAATAGAAAATTCAACGAGCAGGCAAGTGACGTTTTCGAAAAGACGAAATGGACTTACAAG
AAAGCTTATGAATTATCAGTTCTTTGTGATGCTGAAGTTGCTTTCATTATTTTCTCACATAAAGGAAGACTTTATGAATTTGCTAGCTCC
AACATGCAGAAGATAATTGAGAGATACCGAGGACGTGCAAGAGAAACAACGACGGTGGACAAAAGCACTGAACTCGAGCACTACATGGAG
AACTTGAAGCATGAAACAGCTAATATGGCGAAGAAGATAGAGATCCTCGAAATTTCTAAACGGAAGCTAATGGGGCAAGGATTAGGGTCA
TGTTCAATGGATGAACTAGAAGACATTGACAGCCAACTGGAGAGGACCCTCAAAATTATCAGGGCTAGAAAGACTCAATTGTTCAAAGAG
GAAATAGAAAGTXCTAAAAGCAAAGGAGAGACTATTGCTCCAACAAAATGCAAGXTTTACGTGAAAAGTGCXGGGCTTAGGCCAATGCAA
TCAGAGTCAGCACCCGCACCTGCACCCGAACCCATACCAGCACCACCATCAACACCACCAGCTCAATCAAAAGAAAGGGGAAATTGTAGC
CAAAGTACAAAGAGTTGGGAAGTGGAGACTGAATTGTTTATTGCCTTCCTCAAACGCGCTGCTTATAGTAGCTTGGATCAGTGGTTGAGC
CAGGTTTTTTTTTTTTATCAAAGGAATTCAAACCTCGAAGAAGTACACAGAGAAGGCAAAATTGGGTTCAATCTCTACTCTATATACACT
ACATTAAAAGATAAXATTTTAACTATATATGTTATAATGTTATTTTTCGCTGTAGGAGAATCAGTTAAACAACCCCACCAATCCTACGTG
GCTCCGCCCCGACCGGGACAATGG
Edits in Original Sequence 
GAGATGCATACATCAAACCCATAAATAAAGATCCTTCATATATATATATTCTTGTTTCTTCTTCTGTTTATATATATATATATATTTTCT
AGGAATCTAATTCCTTAACTATTTTCTTTTCCATCCTCTTTCCTTTTTCCCGGAAAATCGGAATTTAA
(5')ATGGTGAGAGGAAAAGTA
GAAAXTGAAAAGAATAGAAAATTCAACGAGCAGGCAAGTGACGTTTTCGAAAAGACGAAATGGACTTACgAAGAAAGCTTATGAATTATC
AGTTCTTTGTGATGCTGAAGTTGCTTTCATTATTTTCTCACATAAAGGAAGACTTTATGAATTTGCTAGCTCCAACATGCAGAAGATAAT
TGAGAGATACCGAGGACGTGCAAGAGAAACAACGACGGTGGACAAAAGCACTGAACTCGAGCACTACATGGAGAACTTGAAGCATGAAAC
AGCTAATATGGCGAAGAAGATAGAGATCCTCGAAATTTCTAAACGGAAGCTAATGGGGCAAGGATTAGGGTCATGTTCAATGGATGAACT
AGAAGACATTGACAGCCAACTGGAGAGGACCCTCAAAATTATCAGGGCTAGAAAGACTCAATTGTTCAAAGAGGAAATAGAAAGTXCTAA
AAGCAAAGGAGAGACTATTGCTCCAACAAAATGCAAGXTTTACGTGAAAAGTGCXGGGCTTAGGCCAATGCAATCAGAGTCAGCACCCGC
ACCTGCACCCGAACCCATACCAGCACCACCATCAACACCACCAGCTCAATCAAAAGAAAGGGGAAATTGTAGCCAAAGTACAAAGAGTTG
GGAAGTGGAGACTGAATTGTTTATTgGCCTTCCTCAAACGCGCTGCTTATAGTAGCTTGGATCAGTGGTTGAGCCAGGTTTTTTTTTTTT
ATCAAAGGAATTCAAACCTCGAAGAAGTACACAGAGAAGGCAAAATTGGGTTCAATCTCTACTCTATATACACTACATTAAAAGATAAXA
TTTTAACTATATATGTTATAATGTTATTTTTCGCTGTAGGAGAATCAGTTAAACAACCCCACCAATCCTACGTGGCTCCGCCCCGACCGG
GACAATGG(3')GACCATTTGTTCATATTTTGTTTATGGTTCTCCTCAGTTATTTAGATTAAGAGGTTAGGATTTCTCAGTTATTTACAA
CCATAAGGAGTTGCAAAATTCAATAAATAATACCTTACAATAAGAGTGTAATATTTCTTTCTATTTTTCATGTATTTATAGTATACTTTC
TATTTTTCAAACATTCTAAACAGCTCAATTGTTTTGAGTGTATCACAAGTTTGTTTTTGGTTTATAATGGATTATAAAATTTATAGGTGA
ATTCAAAATTTG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan