ESTScan Details for Unigene SGN-U577438

Score 
971
Direction 
Forward
Predicted Peptide Sequence 
XRVYIGSFNDKPVNEEAVGPMGKGLFEKEQDDLLDDLIDIPKKACDRRINEFVKRARAAKIHAYIMGHLKKEMPALMGKSKTQQKLIQNL
ENEFEKVQKAFRLPAGDFPSVDHFREVLGHYNITDFEKLKPRMIQAVDDMLSHDIPELLKSFRNPYDKKLLIFNFFLDDDDSXMLVLSFE
VFTEICAFFXTVVNPYFIYFKVXDKLAVTVFESVIISANFPASGLTAEYTVFGRRAIPPTNKVIMPALVVTEETMASELSKKKMKKTPKT
DIETPTDKKTKEKKSKKSKIESGSDSEDAKRSKKKEKKRKALDLDGEKSDTSSEICEPVDLKKNKKAKFDDEQVMVEKKVEDPNALSNFR
ISKPLKEALNSKGIEALFPIQAMTFDDILDGCDLVGRARTGQGKTLAFVLPILESLTNGPTKALRKTGYGKAPSVLVLLPTRELALQVFA
DFEVYGRAVGLTSCCLYGNSPMGAQQAQLKRGVDIVVGTPGRVKDHIERGNIDFGSLKFRVLDEVDEMLKIGFVDDVEFILGKVEDASLV
QTVLFSX
Predicted Coding Sequence 
XGGCGAGTCTATATAGGCTCTTTCAATGATAAACCAGTTAATGAAGAAGCTGTTGGTCCTATGGGGAAGGGTCTTTTCGAGAAAGAACAA
GATGACCTGCTTGATGACTTGATAGATATCCCAAAGAAGGCTTGTGACCGTCGAATCAATGAATTTGTTAAACGTGCAAGAGCCGCTAAG
ATACATGCCTACATTATGGGCCATCTTAAGAAGGAGATGCCAGCACTAATGGGCAAGTCCAAAACACAACAGAAGCTCATTCAGAATCTT
GAAAACGAATTCGAAAAGGTCCAGAAAGCGTTTCGTTTACCAGCAGGCGATTTTCCGAGTGTTGATCATTTTAGGGAAGTTTTGGGTCAT
TACAACATCACTGATTTTGAAAAATTGAAGCCTAGAATGATTCAAGCTGTGGATGATATGCTTAGCCATGACATTCCTGAGCTTCTGAAG
AGCTTCAGAAATCCTTATGATAAAAAGCTCTTAATTTTTAATTTTTTTTTAGATGATGATGATTCAGAXATGTTAGTTTTATCTTTTGAG
GTATTTACTGAAATTTGTGCATTCTTTGXCACTGTGGTGAATCCATATTTCATTTACTTCAAAGTTGXTGATAAATTGGCAGTCACAGTT
TTTGAATCTGTTATCATTAGTGCTAACTTTCCTGCTTCTGGCCTAACTGCAGAATACACCGTTTTCGGCAGGAGAGCAATTCCCCCTACA
AACAAAGTCATCATGCCTGCACTTGTTGTAACTGAAGAAACAATGGCCTCCGAGCTATCCAAGAAAAAAATGAAGAAGACACCCAAAACT
GATATTGAAACTCCTACTGATAAGAAAACCAAAGAGAAAAAGTCAAAAAAATCCAAGATTGAGTCTGGGTCTGATTCAGAGGACGCTAAA
AGGAGTAAAAAGAAAGAGAAAAAGAGAAAAGCTTTGGACTTGGATGGTGAGAAGAGTGATACGAGCTCAGAGATATGCGAGCCCGTAGAT
TTGAAGAAGAATAAAAAGGCTAAATTCGACGACGAACAAGTGATGGTTGAGAAGAAAGTCGAGGATCCTAATGCTTTGTCTAATTTTAGG
ATTTCAAAGCCTTTAAAAGAGGCTTTGAATTCTAAGGGAATAGAAGCACTTTTTCCTATTCAAGCTATGACTTTTGATGATATTCTTGAT
GGATGTGATTTGGTTGGTCGAGCTCGTACTGGGCAGGGTAAAACGCTGGCCTTTGTTTTACCCATATTGGAGTCCCTAACGAATGGTCCT
ACTAAAGCATTACGAAAAACAGGGTATGGGAAGGCTCCTAGTGTTCTGGTGCTTTTACCTACTAGGGAATTGGCACTTCAGGTGTTTGCT
GACTTTGAAGTCTATGGCCGGGCTGTTGGGCTCACTTCATGCTGTTTGTATGGAAATTCTCCTATGGGGGCACAACAGGCTCAACTAAAA
AGAGGAGTTGACATTGTAGTGGGTACTCCTGGAAGGGTTAAGGACCACATTGAAAGGGGAAATATTGATTTCGGGTCTTTGAAGTTCCGT
GTTCTTGATGAAGTCGATGAAATGTTAAAAATTGGTTTTGTAGATGATGTCGAATTTATTTTAGGCAAGGTCGAAGATGCAAGCCTAGTT
CAAACAGTTCTTTTCAGTGXX
Edits in Original Sequence 
(5')XGGCGAGTCTATATAGGCTCTTTCAATGATAAACCAGTTAATGAAGAAGCTGTTGGTCCTATGGGGAAGGGTCTTTTCGAGAAAGA
ACAAGATGACCTGCTTGATGACTTGATAGATATCCCAAAGAAGGCTTGTGACCGTCGAATCAATGAATTTGTTAAACGTGCAAGAGCCGC
TAAGATACATGCCTACATTATGGGCCATCTTAAGAAGGAGATGCCAGCACTAATGGGCAAGTCCAAAACACAACAGAAGCTCATTCAGAA
TCTTGAAAACGAATTCGAAAAGGTCCAGAAAGCGTTTCGTTTACCAGCAGGCGATTTTCCGAGTGTTGATCATTTTAGGGAAGTTTTGGG
TCATTACAACATCACTGATTTTGAAAAATTGAAGCCTAGAATGATTCAAGCTGTGGATGATATGCTTAGCCATGACATTCCTGAGCTTCT
GAAGAGCTTCAGAAATCCTTATGaATAAAAAGCTCTTAAtTTTTTAATTTTTTTTTAGATGaATGATGATTCAGAXATGTTAGTTTTATC
TTTTGAGGTATTTACTGAAATTTGTGCATTCTTTGXCACTGTGGTGAATCCATATTTCATTTACTTCAAAGTTGXTGATAAATTGGCAGT
CACAGTTTTTGtAATCTGTTATCATTAGTGCTAACTTTCCTGCTTCTGcGCCTAACTGCAGAATACACCGTTTTCGGCAGGAGAGCAATT
CCCCCTACAAACAAAGTCATCATGCCTGCACTTGTTGTAACTGAAGAAACAATGGCCTCCGAGCTATCCAAGAAAAAAATGAAGAAGACA
CCCAAAACTGATATTGAAACTCCTACTGATAAGAAAACCAAAGAGAAAAAGTCAAAAAAATCCAAGATTGAGTCTGGGTCTGATTCAGAG
GACGCTAAAAGGAGTAAAAAGAAAGAGAAAAAGAGAAAAGCTTTGGACTTGGATGGTGAGAAGAGTGATACGAGCTCAGAGATATGCGAG
CCCGTAGATTTGAAGAAGAATAAAAAGGCTAAATTCGACGACGAACAAGTGATGGTTGAGAAGAAAGTCGAGGATCCTAATGCTTTGTCT
AATTTTAGGATTTCAAAGCCTTTAAAAGAGGCTTTGAATTCTAAGGGAATAGAAGCACTTTTTCCTATTCAAGCTATGACTTTTGATGAT
ATTCTTGATGGATGTGATTTGGTTGGTCGAGCTCGTACTGGGCAGGGTAAAACGCTGGCCTTTGTTTTACCCATATTGGAGTCCCTAACG
AATGGTCCTACTAAAGCATTACGAAAAACAGGGTATGGGAAGGCTCCTAGTGTTCTGGTGCTTTTACCTACTAGGGAATTGGCACTTCAG
GTGTTTGCTGACTTTGAAGTCTATGGCCGGGCTGTTGGGCTCACTTCATGCTGTTTGTATGGAAATTCTCCTATGGGGGCACAACAGGCT
CAACTAAAAAGAGGAGTTGACATTGTAGTGGGTACTCCTGGAAGGGTTAAGGACCACATTGAAAGGGGAAATATTGATTTCGGGTCTTTG
AAGTTCCGTGTTCTTGATGAAGTCGATGAAATGTTAAAAATTGGTTTTGTAGATGATGTCGAATTTATTTTAGGCAAGGTCGAAGATGCA
AGCCTAGTTCAAACAGTTCTTTTCAGTGXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan