ESTScan Details for Unigene SGN-U577663

Score 
492
Direction 
Forward
Predicted Peptide Sequence 
MAGMLPGVECARRRRFHQSNGCIDSSNTSSFSSTRRSSFCLYTSNHEHHLNSSSSKQRGVISQAYQDEKLGEAVREAKQRLDERLSARWK
SQNKRGLNNRQKPNQNQEMVENRPNLQGEVFSGLKRSGSKKFNWAKMIWKSQEQDECSICLDQFKISDNXNAIDMCPQIPFQVFGAMA
Predicted Coding Sequence 
ATGGCTGGTATGCTACCTGGTGTTGAATGTGCTAGAAGAAGGAGATTTCATCAAAGTAATGGATGTATAGATTCATCAAACACCTCTAGT
TTTTCATCCACAAGAAGGTCTTCTTTTTGTCTATACACTAGTAATCATGAACACCACCTCAATTCAAGTTCATCCAAGCAAAGGGGTGTA
ATAAGTCAAGCATATCAAGATGAGAAACTAGGTGAAGCTGTAAGAGAAGCCAAGCAAAGGTTGGATGAGAGGCTTAGTGCAAGATGGAAA
TCACAAAATAAGAGGGGTCTCAACAATAGACAAAAACCAAACCAAAACCAAGAGATGGTGGAGAATAGGCCAAATTTGCAAGGAGAAGTA
TTTTCAGGACTAAAGAGAAGTGGATCAAAGAAGTTTAATTGGGCAAAAATGATTTGGAAATCTCAAGAACAGGATGAATGTTCAATTTGC
TTGGATCAATTCAAGATTAGTGATAACTTXAATGCAATTGACATGTGCCCACAAATTCCATTCCAAGTGTTTGGTGCCATGGCT
Edits in Original Sequence 
CAATTATCTCGATATTCCTTCCATCTCAGTTTATATTTTAGTTAAATAATTTCTTGTACTACATATTTTTAATTACTAACAATATTGAAT
TGTTAGCAAGTATTTAAAATTTTCAAATATATTTTTATTTTAAAGAATTAAGTATTTTAACCTTTGTACTACGTCATCGTATAAATTCAG
ACGCAAGAAATACTAGTAATACATAAGGTGTAGGAAGAGAAAGATTTCCTCTATCTCCTTCATTTTTTTACTAAAAAAAAAAGAAGTTGC
TAGTGAGTTAGGCCTATATAGTGTGTTACTTTTTGGTTCTTCACAATATTTTTCTCTATTTCCTCTATTGTGTTTTATGTAAAA
(5')AT
GGCTGGTATGCTACCTGGTGTTGAATGTGCTAGAAGAAGGAGATTTCATCAAAGTAATGGATGTATAGATTCATCAAACACCTCTAGTTT
TTCATCCACAAGAAGGTCTTCTTTTTGTCTATACACTAGTAATCATGAACACCACCTCAATTCAAGTTCATCCAAGCAAAGGGGTGTAAT
AAGTCAAGCATATCAAGATGAGAAACTAGGTGAAGCTGTAAGAGAAGCCAAGCAAAGGTTGGATGAGAGGCTTAGTGCAAGATGGAAATC
ACAAAATAAGAGGGGTCTCAACAATAGACAAAAACCAAACCAAAACCAAGAGATGGTGGAGAATAGGCCAAATTTGCAAGGAGAAGTATT
TTCAGGACTAAAGAGAAGTGGATCAAAGAAGTTTAATTGGGCAAAAATGATTTGGAAATCTCAAGAACAGGATGAATGTTCAATTTGCTT
GGATCAATTCAAGATTAGTGATAACTTXAATGCAATTGACATGTGCCCACAAATTCCATTCCAAGTGTTTGGTGCCATGGCT(3')AGAA
TTCAATGCACATTGTCCATGTTGTAGAATGACAATAATATTGACTAGTACTAGTGCATAATTAGGAAAATGGAAGGAAGTTGCATATGTC
TTTTTCTACAACTTGTAGGTGTCCAAGATTTTCTAAAATGTACAAAATTATATATATAGAGAGAGATATAATAGGTGTCTTGTAATTGAA
TCTATTGACTATTTTTTTATCGTATAAGAAAAAACTTTTATGAAGTTTGAGATATGGTGGATGGGAGA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan