Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U577718

Score 
1109
Direction 
Forward
Predicted Peptide Sequence 
ISELKSNFTNNFGAHQIKAASINXKTLEGIYQDDPVCPFAGASRPDDATLNKPYDENKQQAQESKPKKESGEVATVSPKCPFGYDSTLKK
PCDDQNKQQDGQESKPKQDSGESATVSPKCPFGYDGQESKPKQDSGESATVSPKCPFGYDGQKSKPKQDSGESATMSPKCPFGYDSQAFK
LGPFSCMICQALLYEAADVCPVHMYSARHVSPALRTXPLCGADIEKIEADMNLQNVVDRFIEGHARIKRSNNEQEDIVEKKTVIYEDASL
ERGAFLVQQAMRAFRANNIDSAKSRFTMCADDIREQLQRMGNTSELCSQLGAVLGMLGDCSRATGDAVSAVAYFEESVNFLLKVPKDDVE
ITHTLSVSLNKIGDLKYYAGDLQTARSHYFRALDVRRNAIKQQSVPSQVVDVAISLAKVADIDRNLGDEDTAVEGFQEGIKLLQSLELKP
EEVSLEXTAAISARVPXTANLKRTKLNSAAXNEVLSYIVKDE*
Predicted Coding Sequence 
ATATCGGAATTGAAATCTAATTTCACCAATAATTTTGGGGCACATCAAATCAAAGCTGCTTCGATTAACXGCAAAACCCTAGAGGGAATT
TATCAAGATGATCCAGTTTGCCCTTTTGCTGGAGCTTCCAGACCCGATGATGCAACTCTTAATAAACCATATGACGAAAATAAACAACAG
GCTCAAGAGAGCAAGCCTAAAAAAGAATCTGGAGAAGTTGCTACGGTGTCACCTAAATGCCCCTTTGGATATGATTCAACTCTTAAGAAA
CCTTGTGACGACCAAAATAAACAACAGGATGGCCAGGAGAGCAAGCCTAAACAAGACTCTGGAGAATCTGCAACTGTGTCACCTAAGTGC
CCCTTTGGATATGATGGCCAGGAGAGCAAGCCTAAACAAGACTCTGGAGAATCTGCAACCGTGTCACCTAAGTGCCCCTTCGGATATGAT
GGCCAGAAGAGCAAGCCTAAACAAGACTCTGGAGAATCTGCGACAATGTCACCTAAGTGCCCCTTTGGTTATGATTCTCAAGCATTTAAA
CTGGGTCCTTTTAGCTGCATGATATGTCAAGCACTTCTTTATGAAGCAGCAGATGTGTGCCCTGTTCACATGTATTCTGCAAGGCATGTC
TCTCCCGCTTTAAGGACTGXTCCATTGTGTGGTGCTGATATTGAAAAGATTGAGGCCGATATGAATCTTCAGAATGTTGTCGATCGCTTT
ATTGAAGGGCATGCAAGGATTAAGAGGTCTAATAATGAGCAAGAAGATATAGTGGAAAAGAAAACTGTTATATACGAGGATGCATCTTTG
GAGCGTGGAGCTTTCCTGGTTCAACAAGCCATGCGGGCTTTTCGTGCCAATAATATTGATAGTGCAAAATCAAGATTTACTATGTGTGCA
GATGACATCAGAGAACAGCTTCAGAGAATGGGGAATACATCAGAGTTGTGCTCACAGCTCGGAGCAGTTCTTGGTATGCTTGGTGACTGC
AGTCGAGCTACAGGAGATGCTGTATCTGCAGTCGCTTACTTTGAAGAGAGTGTCAATTTCCTTTTGAAAGTACCCAAAGATGATGTAGAG
ATCACACATACACTTTCTGTTTCACTAAACAAAATTGGAGATCTTAAATACTATGCCGGTGATTTGCAAACTGCCAGATCTCATTATTTT
CGGGCGTTGGATGTTCGCCGCAATGCCATCAAGCAACAGTCTGTGCCATCTCAGGTAGTCGATGTAGCCATTTCCTTAGCCAAAGTTGCT
GATATCGATCGAAATCTCGGGGATGAGGATACTGCAGTTGAAGGATTTCAAGAAGGCATAAAGTTACTGCAATCCCTTGAACTAAAACCC
GAAGAAGTTAGCCTTGAAXCAACGGCGGCAATCAGTGCTCGAGTTCCTXCAACAGCCAACTTGAAAAGAACGAAACTTAACTCAGCTGCC
CXGAATGAAGTCCTTTCCTACATAGTTAAGGACGAATAA
Edits in Original Sequence 
CAAAATAAAAAAATTGAATATAATATATCCTGGTTTCCATTATTTGAAAAGGGGAAAAAATAATAAAGAAAAAGATTTATCTTTTGGTTG
ATCAGAAAAATTTTCACA
(5')ATATCGGAATTGAAATCTAATTTCACCAATAATTTTGGGGCACATCAAATCAAAGtCTGCTTCGATTA
ACXGCAAAACCCTAGAGGGAATTTATCAAGATGATcCCAGTTTGCCCTTTTGCTGGAGCTTCCAGACCCGATGATGCAACTCTTAATAAA
CCATATGACGAAAATAAACAACAGGCTCAAGAGAGCAAGCCTAAAAAAGAATCTGGAGAAGTTGCTACGGTGTCACCTAAATGCCCCTTT
GGATATGATTCAACTCTTAAGAAACCTTGTGACGACCAAAATAAACAACAGGATGGCCAGGAGAGCAAGCCTAAACAAGACTCTGGAGAA
TCTGCAACTGTGTCACCTAAGTGCCCCTTTGGATATGATGGCCAGGAGAGCAAGCCTAAACAAGACTCTGGAGAATCTGCAACCGTGTCA
CCTAAGTGCCCCTTCGGATATGATGGCCAGAAGAGCAAGCCTAAACAAGACTCTGGAGAATCTGCGACAATGTCACCTAAGTGCCCCTTT
GGTTATGATTCTCAAGCATTTAAACTGGGTCCTTTTAGCTGCATGATATGTCAAGCACTTCTTTATGAgAGCAGCAGATGTGTGCCCTGT
TCACATGTATTCTGCAAGGCATGTCTCTCCCGCTTTAAGGACTGXTCCATTGTGTGGTGCTGATATTGAAAAGATTGAGGCCGATATGAA
TCTTCAGAATGTTGTCGATCGCTTTATTGAAGGGCATGCAAGGATTAAGAGGTCTAATAATGAGCAAGAAGATATAGTGGAAAAGAAAAC
TGTTATATACGAGGATGCATCTTTGGAGCGTGGAGCTTTCCTGGTTCAACAAGCCATGCGGGCTTTTCGTGCCAATAATATTGATAGTGC
AAAATCAAGATTTACTATGTGTGCAGATGACATCAGAGAACAGCTTCAGAGAATGGGGAATACATCAGAGTTGTGCTCACAGCTCGGAGC
AGTTCTTGGTATGCTTGGTGACTGCAGTCGAGCTACAGGAGATGCTGTATCTGCAGTCGCTTACTTTGAAGAGAGTGTCAATTTCCTTTT
GAAAGTACCCAAAGATGATGTAGAGATCACACATACACTTTCTGTTTCACTAAACAAAATTGGAGATCTTAAATACTATGCCGGTGATTT
GCAAACTGCCAGATCTCATTATTTTCGGGCGTTGGATGTTCGCCGCAATGCCATCAAGCAACAGTCTGTGCCATCTCAGGTAGTCGATGT
AGCCATTTCCTTAGCCAAAGTTGCTGATATCGATCGAAATCTCGGGGATGAGGATACTGCAGTTGAAGGATTTCAAGAAGGCATAAAGTT
ACTGCAATCCCTTGAACTAAAACCCGAAGAAGTTAGCCTTGAAXCAACGGCGGCAATCAGTGCTCGAGTTCCTXCAACAGCCAACTTGAA
AAGAACGAAACTTAACTCAGCTGCCCXGAATGAAGTCCTTTCCTACATAGTTAAGGACGAATAA(3')GAACAATGTGTGTTCTCTCATA
TAGTTTGGTGTAAACACTAGATGCTCGGTTCAGAGGCAACCTGAGATAAACTTCGATGTAATCGCCGTAGAATAAGTGAGATTTTTAATA
GTAATATGCCTGTGGCAAAGTCAATATAGTCCTATGTTCCAAAATCTCAGTATCTTGTGTATGTATCTTTACCACAAGTTGACAATATTA
TTAAGTTATTGGAGGTTTATGACAATGTTATAAAAGTATAATGTGTGCTTCTC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan