ESTScan Details for Unigene SGN-U577734

Score 
425
Direction 
Forward
Predicted Peptide Sequence 
XDSIDGTKSFITGKPVFGTLIALLYKGKPILGVIDQPVLRXEVDWFKRATNYLEWARNIHTNCSSLSKAYMYTTSPHLFEGDAEIAFARV
RSKVKVPLYGCDCYAYALLASGFVDLVVESGLKPYDFLSLVPVIEGAGGTITDWKGQHFNWKASAGSPATSFNVVAAGDKEVHQEALDAX
AVAVEAAMFHCIGSQLPLANIIVIDYFAAESLH*
Predicted Coding Sequence 
XXCGATTCAATAGATGGTACTAAGAGTTTCATCACAGGGAAACCTGTGTTTGGCACTCTTATTGCTCTGTTGTACAAAGGTAAACCGATT
CTTGGCGTTATTGACCAGCCTGTACTGAGAGAXGAGGTGGATTGGTTTAAGCGGGCGACGAACTACCTTGAATGGGCAAGAAATATCCAC
ACCAACTGTTCAAGTCTTTCAAAAGCCTACATGTACACTACTAGCCCACATTTGTTCGAAGGGGATGCTGAGATTGCCTTTGCTCGTGTT
AGAAGCAAGGTGAAAGTTCCACTGTACGGATGTGACTGCTATGCTTATGCCCTATTGGCTTCTGGATTTGTGGATCTTGTAGTAGAGTCT
GGTCTTAAGCCGTACGACTTCCTCTCACTTGTACCAGTAATAGAAGGTGCTGGAGGAACAATAACCGACTGGAAAGGCCAACATTTTAAT
TGGAAAGCTTCTGCTGGTTCACCAGCCACAAGTTTTAATGTAGTGGCAGCCGGTGATAAAGAAGTTCACCAAGAAGCTCTGGATGCAXTT
GCAGTGGCGGTAGAGGCTGCTATGTTTCACTGTATTGGCTCACAACTCCCTTTGGCGAATATCATAGTTATTGATTACTTTGCCGCTGAG
TCTCTACATTAA
Edits in Original Sequence 
(5')XXCGATTCAATAGATGGTACTAAGAGTTTCATCACAGGGAAACCTGTGTTTGGCACTCTTATTGCTCTGTTGTACAAAGGTAAACC
GATTCTTGGCGTTATTGACCAGCCTGTACTGAGAGAXGAGGTGGATTGGTTTAAGCGGGCGACGAACTACCTTGAATGGGCAAGAAATAT
CCACACgCAACTGTTCAAGTCTTTCAAAAGCCTACATGTACACTACTAGCCCACATTTGTTCGAAGGGGATGCTGAGATTGCCTTTGCTC
GTGTTAGAAGCAAGGTGAAAGTTCCACTGTACGGATGTGACTGCTATGCTTATGCCCTATTGGCTTCTGGATTTGTGGATCTTGTAGTAG
AGTCTGGTCTTAAGCCGTACGACTTCCTCTCACTTGTACCAGTAATAGAAGGTGCTGGAGGAACAATAACCGACTGGAAAGGCCAACATT
TTAATTGGAAAGCTTCTGCTGGTTCACCAGCCACAAGTTTTAATGTAGTGGCAGCCGGTGATAAAGAAGTTCACCAAGAAGCTCTGGATG
CAXTTGCAGTGGCGGTAGAGGCTGCTATGTTTCACTGTATTGGCTCACAACTCCCTTTGGCGAATATCATAGTTATTGATTACTTTGCCG
CTGAGTCTCTACATTAA(3')TTTTAACTTTTGAATCAAATTATGGTGGTCCTCTGTTGATAGTTATTTAATCAGAATGCTTACTTG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan