Notice: If you try to use Google Chrome to access the SGN FTP site, please check this link to resolve connection issues.

ESTScan Details for Unigene SGN-U577789

Score 
1696
Direction 
Forward
Predicted Peptide Sequence 
MAGNGVFAEIIDGEVYKYYCEGEWKKSASGKSVAIINPTTRKTQYKVQACTQEEVNKVMEIAKAAQKSWAKTPLWKRAELLHKAAAILKE
HKAPIAECLVKEIAKPAKDAVTEVVRSGDLVSYTAEEGVRILGEGKFLVSDSFPGNERTKYCLTSKIPLGVILAIPPFNYPVNLAVSKIA
PALIAGNSLVLKPPTQGAVAALHMVHCFHLAGFPKGLISCVTGKGSEIGDFLTMHPGVNCISFTGGDTGVAISKKAGMVPLQMELGGKDA
CIVLEDADLDLAAGNIVKGGFSYSGQRCTAVKVVLVMESVADILVEKVNAKVAKLTVGPPEDNCDITPVVSESSANFIEGLVMDAKEKDA
TFCQPYKREGNLIWPLLLDNVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAMETGTVQINSAPA
RGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINLPTPSYTMG*
Predicted Coding Sequence 
ATGGCTGGAAATGGAGTATTTGCAGAAATAATTGATGGAGAAGTGTACAAATATTATTGTGAAGGAGAATGGAAAAAATCAGCTTCTGGA
AAATCTGTTGCTATTATTAATCCTACTACAAGAAAGACACAATACAAAGTTCAAGCATGTACACAAGAAGAGGTGAACAAAGTAATGGAA
ATAGCAAAAGCAGCACAAAAATCATGGGCTAAAACACCACTATGGAAAAGAGCAGAGTTACTTCATAAGGCAGCTGCAATTTTGAAAGAA
CACAAAGCCCCTATTGCTGAATGCCTTGTTAAAGAAATTGCAAAACCAGCTAAAGATGCTGTCACCGAGGTTGTGAGATCTGGTGATTTG
GTTTCTTACACTGCTGAAGAAGGAGTTAGAATTCTAGGGGAGGGTAAGTTCTTGGTATCTGATAGTTTCCCTGGAAATGAAAGGACCAAA
TACTGTCTAACATCCAAGATACCGTTGGGTGTGATTCTGGCGATTCCTCCTTTCAACTATCCGGTCAATCTTGCCGTCTCCAAGATTGCT
CCTGCACTGATTGCTGGAAACTCTTTAGTCCTCAAGCCTCCAACTCAGGGTGCTGTGGCTGCCCTGCATATGGTGCATTGCTTCCACTTA
GCTGGATTCCCTAAAGGCCTTATCAGTTGTGTGACCGGAAAAGGTTCTGAAATCGGAGATTTTCTCACTATGCATCCTGGAGTAAACTGT
ATAAGCTTCACTGGTGGAGACACCGGTGTTGCAATCTCGAAGAAAGCAGGAATGGTCCCTCTACAGATGGAGCTGGGAGGAAAGGATGCT
TGTATCGTGCTCGAGGATGCTGATTTAGATTTGGCTGCTGGAAACATTGTGAAAGGAGGATTTTCTTACAGTGGTCAAAGATGCACAGCC
GTTAAGGTCGTGTTGGTGATGGAATCTGTTGCTGACATTCTTGTTGAGAAGGTAAATGCCAAAGTGGCAAAGTTAACCGTTGGGCCACCC
GAAGATAATTGTGATATCACTCCAGTTGTCTCCGAGTCATCCGCAAATTTCATCGAGGGGCTGGTCATGGACGCAAAGGAGAAAGATGCA
ACATTTTGCCAGCCATACAAGAGAGAAGGCAACCTTATCTGGCCCTTGTTGTTAGACAATGTTAGGCCGGACATGAGAATCGCTTGGGAA
GAACCCTTCGGTCCAGTTTTGCCCGTTATTCGGATCAACTCAGTCGAAGAAGGAATTCACCACTGCAATGCTAGCAATTTCGGTCTGCAG
GGTTGTGTGTTCACCAAAGACATCAACAAAGCAATACTGATCAGTGATGCAATGGAAACCGGAACCGTTCAGATTAACTCAGCTCCTGCT
CGTGGACCGGATCATTTTCCGTTCCAGGGTATTAAGGACAGTGGAATTGGATCACAAGGGATCACTAACAGTATTAACATGATGACTAAA
GTGAAGACCACTGTGATCAATTTGCCAACCCCTTCTTATACTATGGGGTAA
Edits in Original Sequence 
GGGGACTCACTCTAAATTCACCCAAAAAAAATAATAAAAATCCACCATTTTCTCTTCTTATCCTTTTTTTTTTTAATTATTGTGAAAAAA
AATCTAAAATTTGGTGTAAAA
(5')ATGGCTGGAAATGGAGTATTTGCAGAAATAATTGATGGAGAAGTGTACAAATATTATTGTGAAGG
AGAATGGAAAAAATCAGCTTCTGGAAAATCTGTTGCTATTATTAATCCTACTACAAGAAAGACACAATACAAAGTTCAAGCATGTACACA
AGAAGAGGTGAACAAAGTAATGGAAATAGCAAAAGCAGCACAAAAATCATGGGCTAAAACACCACTATGGAAAAGAGCAGAGTTACTTCA
TAAGGCAGCTGCAATTTTGAAAGAACACAAAGCCCCTATTGCTGAATGCCTTGTTAAAGAAATTGCAAAACCAGCTAAAGATGCTGTCAC
CGAGGTTGTGAGATCTGGTGATTTGGTTTCTTACACTGCTGAAGAAGGAGTTAGAATTCTAGGGGAGGGTAAGTTCTTGGTATCTGATAG
TTTCCCTGGAAATGAAAGGACCAAATACTGTCTAACATCCAAGATACCGTTGGGTGTGATTCTGGCGATTCCTCCTTTCAACTATCCGGT
CAATCTTGCCGTCTCCAAGATTGCTCCTGCACTGATTGCTGGAAACTCTTTAGTCCTCAAGCCTCCAACTCAGGGTGCTGTGGCTGCCCT
GCATATGGTGCATTGCTTCCACTTAGCTGGATTCCCTAAAGGCCTTATCAGTTGTGTGACCGGAAAAGGTTCTGAAATCGGAGATTTTCT
CACTATGCATCCTGGAGTAAACTGTATAAGCTTCACTGGTGGAGACACCGGTGTTGCAATCTCGAAGAAAGCAGGAATGGTCCCTCTACA
GATGGAGCTGGGAGGAAAGGATGCTTGTATCGTGCTCGAGGATGCTGATTTAGATTTGGCTGCTGGAAACATTGTGAAAGGAGGATTTTC
TTACAGTGGTCAAAGATGCACAGCCGTTAAGGTCGTGTTGGTGATGGAATCTGTTGCTGACATTCTTGTTGAGAAGGTAAATGCCAAAGT
GGCAAAGTTAACCGTTGGGCCACCCGAAGATAATTGTGATATCACTCCAGTTGTCTCCGAGTCATCCGCAAATTTCATCGAGGGGCTGGT
CATGGACGCAAAGGAGAAAGATGCAACATTTTGCCAGCCATACAAGAGAGAAGGCAACCTTATCTGGCCCTTGTTGTTAGACAATGTTAG
GCCGGACATGAGAATCGCTTGGGAAGAACCCTTCGGTCCAGTTTTGCCCGTTATTCGGATCAACTCAGTCGAAGAAGGAATTCACCACTG
CAATGCTAGCAATTTCGGTCTGCAGGGTTGTGTGTTCACCAAAGACATCAACAAAGCAATACTGATCAGTGATGCAATGGAAACCGGAAC
CGTTCAGATTAACTCAGCTCCTGCTCGTGGACCGGATCATTTTCCGTTCCAGGGTATTAAGGACAGTGGAATTGGATCACAAGGGATCAC
TAACAGTATTAACATGATGACTAAAGTGAAGACCACTGTGATCAATTTGCCAACCCCTTCTTATACTATGGGGTAA(3')ATTAATCACT
ATTTTTTGCTTTAGAAATTTGACAATAATAATTAAGTATCCATGTTGTGGATGTTAATAAGTTCACACCAATTATTGTTCATTTCTTTCG
TTGACCTTATGAAGATTAATATTGGTGGGTTAGTATTTAGCATTATTCTCGTAGTTTCTTGTTCTTCGATTGTTGTTGCTAGCTATTTGT
TGTTTCTTGTGCTTCGTTTATCACATTATTCTACTTTGTATGACATAATAATATGCTTCCTCTAGAGTCTATTGTTTGTTTTGTCTAAAA
AAAAAAAAAAAGAAAGCTGGAGTGGAAGTTGAGAGAAATGAAGAAAATGGATCCTTCACTAAGGAAGGAGTTTGTAAGGCAATCAAACCG
GTAATGAATGATGAGAGTGAAGAGGGGTGTAAAATAAGGGCGAATCGCGCAAAGTGGAGAGAGTTCTTGTTGAGTAAAGGGCTTGAGGAT
TCTTACATTGATGGTCTTGTGCAGAAGCTACAATGTCTACTCTGATTGCAGAACACTGTTTCGACAGCTCGAACCTGTAACTTTGTAACC
TCCTAGTAGTTTGGTGCCAATAAAGTTCTTGTTGAGTAAAAGACTTGAGGATTCTTACATTAATGGTCTTGTGCAAAAGCTACAATGTTT
ACTATGATTGCAAGAGACTGTTTCCACAGCTCGAACCTGTAACGTTGTAACCACCTCCTAGTAGTTTGCCAATAAGTTCTAGTTGCCAAT
AAAAAATGGGATGTTTGTTTCTTGTTTCTACTACTAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan