ESTScan Details for Unigene SGN-U577844

Score 
696
Direction 
Forward
Predicted Peptide Sequence 
RKLKSQIKATKILSHHGKQTKAPQQKQMITDSKSCSPPPIKYPVLRMELEIQVRELQPNTQLKDQTKAELNKTESSSTLDVNXIAFETPA
SHCTVHFPFFWAALGHLGTSWVLLVNILDNTDSNSLPHVRFXISLFSFFYLSFIPLNILFYLERNNNNLTKSKKTVLYLILCKIHQQKQI
SNXSAYLKMKKVILKLEYFDEKIKQKAMKKVSGLEGVESISIDSKEKKLTITGNIDPVSLVSKLRKLCHTDIVSVGPAKEPEKKKDDGAK
KDEGAKKDDGKKDDGAKKGDDKKGGADKTKEEALPVMKAFPAPIFYHYNQHPYQHYQTPVPAYYHQRSVEEDPNSCVIC*
Predicted Coding Sequence 
AGAAAACTTAAATCTCAAATTAAAGCAACAAAAATCCTGAGCCACCATGGAAAACAAACCAAGGCACCTCAACAAAAGCAAATGATAACA
GACTCAAAATCATGCTCGCCACCGCCTATCAAGTACCCAGTTCTGAGAATGGAACTTGAGATACAAGTCAGAGAACTACAACCTAATACA
CAACTCAAAGACCAAACTAAAGCAGAATTAAATAAAACAGAGTCTAGTAGCACACTCGATGTAAATAAXATAGCATTCGAAACACCAGCA
TCACACTGCACAGTTCACTTCCCCTTCTTCTGGGCAGCXCTTGGTCACCTTGGCACCAGTTGGGTCCTTCTTGTCAACATTCTTGACAAC
ACCGACAGCAACAGTCTGCCTCATGTCCGTTTCTXCATTTCTCTTTTCTCTTTCTTCTATTTGTCTTTCATTCCTTTGAATATTCTCTTC
TATTTAGAGAGGAATAATAACAATCTTACAAAAAGTAAGAAAACAGTTCTTTATCTGATACTTTGTAAGATACACCAGCAAAAGCAGATC
TCTAATXTATCAGCATATTTAAAGATGAAGAAAGTAATTCTGAAATTGGAGTATTTCGACGAGAAAATCAAGCAGAAAGCCATGAAGAAA
GTGTCTGGTCTTGAAGGAGTGGAATCAATTTCAATAGATTCAAAAGAGAAGAAATTAACAATTACAGGGAACATAGATCCAGTTTCACTG
GTTTCAAAATTGAGGAAGCTCTGTCACACTGATATCGTCTCAGTTGGACCAGCAAAAGAGCCTGAGAAAAAGAAGGACGACGGTGCCAAA
AAAGATGAAGGGGCTAAAAAGGATGACGGCAAAAAAGATGATGGGGCTAAAAAAGGGGATGATAAAAAAGGAGGAGCCGATAAGACGAAA
GAAGAAGCTCTTCCAGTAATGAAAGCTTTTCCAGCTCCTATATTTTATCACTATAATCAGCATCCTTATCAACATTATCAAACCCCTGTT
CCTGCTTATTATCACCAACGAAGCGTTGAAGAAGATCCAAATTCTTGTGTCATCTGTTGA
Edits in Original Sequence 
(5')AGAAAACTTAAATCTCAAATTAAAGCAACAAAAATCCTGAGCCACCATGGAAAACAAACCAAGGCACCTCAACAAAAGCAAATGAT
AACAGACTCAAAATCATGCTCGCCACCGCCTATCAAGTACCCAGTTCTGAGAATGGAtACTTGAGATACAAGTCAGAGAACTACAACCTA
ATACACAACTCAAAGACCAAACTAAAGCAGAATTAAATAAAACAGAGTCTAGaTAGCACACTCGATGTAAATAAXATAGCATTCGAAACA
CCAGCATCACACTGCACAGTTCACTTCCCCTTCTTCTGGGCAGCXCTTGGTCACCTTGGCACCAGTTGGGTCCTTCTTGTCAACATTCTT
GACAACACCGACAGCAACAGTCTGCCTCATGTCCGTTTCTXCATTTCTCTTTTCTCTTTCTTCTATTTGTCTTTCATTCCTTTGAATATT
CTCTTCTATTTAGAGAcGGAATAATAACAATCTTACAAAAAGTAAGAAAACAGTTCTTTATCTGATACTTTGTAAGATACACCAGCAAAA
GCAGATCTCTAATXTATCAGCATATTTAAAGATGAAGAAAGTAATTCTGAAATTGGAGTATTTCGACGAGAAAATCAAGCAGAAAGCCAT
GAAGAAAGTGTCTGGTCTTGAAGGAGTGGAATCAATTTCAATAGATTCAAAAGAGAAGAAATTAACAATTACAGGGAACATAGATCCAGT
TTCACTGGTTTCAAAATTGAGGAAGCTCTGTCACACTGATATCGTCTCAGTTGGACCAGCAAAAGAGCCTGAGAAAAAGAAGGACGACGG
TGCCAAAAAAGATGAAGGGGCTAAAAAGGATGACGGCAAAAAAGATGATGGGGCTAAAAAAGGGGATGATAAAAAAGGAGGAGCCGATAA
GACGAAAGAAGAAGCTCTTCCAGTAATGAAAGCTTTTCCAGCTCCTATATTTTATCACTATAATCAGCATCCTTATCAACATTATCAAAC
CCCTGTTCCTGCTTATTATCACCAACGAAGCGTTGAAGAAGATCCAAATTCTTGTGTCATCTGTTGA(3')ACTGATATTCATGATGAAT
TTGATTCATATCATGTTATCACTGTTACTCTCTAATATATATTCCCTGCGAGTTTTGTGACTTTTTAAGAAGAAAAAAAATAGCTTTGTA
CAAATTTATGTTTTCTTTTCCCCATGATCACATTTTTGTTCCATGTTTATTACAACATCTCTTTATTGATCTATATATTTGAACAGTGAA
CGGTGATTTAAAGGTCATCTATTTCGAGTTATAGATCGATCAAATC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan