ESTScan Details for Unigene SGN-U578034

Score 
2203
Direction 
Forward
Predicted Peptide Sequence 
MPALGCCVDASVSPPLGYAFSWDSSLPAPELFSSGVPPATNAAAVSTGSHWSTDLSSDLYRVDGWGAPYFSVNSSGDISVRPHGTDTLPH
QEIDLLKVVKKASDPKNLGGLGLQMPLVVRFPDVLKNRLETLQSAFDMAINSQGYEAHYQGVYPVKCNQDRFVVEDIVKFGSPYRFGLEA
GSKPELLLAMNCLSKGSADALLVCNGFKDTEYISLALVARKLLLNSVIVLEQEEELDLVIDISRKMSVRPVIGLRAKLRTKHSGHFGSTS
GEKGKFGLTTTQILRVVKKLDESGMLDCLQLLHFHIGSQIPTTELLADGVGEATQIYSELVRLGAGMKFIDIGGGLGIDYDGSKSSNSDV
SVCYSIEEYASAVVQAVLYVCDRKGVKHPVICSESGRAIVSHHSILIFEAVSASTSHVSTQPSSGGLQSLVETLNEDARADYRNLSAAAV
RGEYDTCLIYSDQLKQRCVEQFKDGSLDIEQLAAVDSICDWVSKAIGVADPVRTYHVNLSVFTSIPDFWGFSQLFPIVPIHRLDEKPTMR
GILSDLTCDSDGKVDKFIGGESSLPLHEIGSGDGGRYYLGMFLGGAYEEALGGLHNLFGGPSVVRVMQSDSPHSFAVTRSVPGPSCADVL
RAMQFEPELMFETLKHRAEEFLEQGEGEGEGVAFGSLTSSLAQSFHNMPYLSSCCFTAEATANANTNTNNGGYYYYSEDNAAAEEDEIWS
Y*
Predicted Coding Sequence 
ATGCCGGCCTTAGGTTGTTGTGTAGACGCTTCTGTTTCCCCTCCTCTCGGCTATGCCTTTTCTTGGGATAGCTCTCTTCCCGCGCCGGAG
TTGTTTTCCTCCGGCGTACCTCCGGCGACAAACGCCGCCGCCGTTTCCACCGGTTCTCATTGGTCTACGGATCTGTCATCTGATTTGTAC
CGGGTAGATGGGTGGGGTGCTCCTTATTTCTCCGTGAACTCTTCCGGGGATATTTCCGTCCGTCCACATGGTACGGATACTCTTCCTCAC
CAGGAGATTGACCTTCTTAAGGTTGTGAAGAAGGCTTCTGACCCGAAAAATTTGGGTGGACTTGGGCTCCAGATGCCTCTTGTTGTCCGT
TTTCCTGATGTTCTGAAGAACCGTTTGGAGACTCTGCAATCGGCTTTTGACATGGCGATTAATTCTCAAGGCTATGAGGCTCACTATCAA
GGTGTTTATCCGGTGAAATGCAATCAAGATAGGTTCGTGGTGGAGGATATCGTGAAATTCGGGTCGCCATACCGATTCGGGCTGGAAGCC
GGGTCTAAACCGGAGCTCCTGTTGGCGATGAACTGTCTGTCAAAGGGCAGTGCTGATGCTCTTCTTGTTTGCAATGGTTTCAAGGACACT
GAGTATATTTCGCTTGCTTTGGTCGCAAGAAAGCTCCTTTTGAACAGTGTGATTGTGCTTGAACAAGAGGAGGAGCTTGACCTGGTGATT
GATATCAGCCGTAAGATGTCTGTCCGGCCTGTAATTGGACTTCGTGCTAAGCTCAGGACAAAGCATTCTGGCCATTTTGGATCCACTTCT
GGTGAAAAGGGTAAGTTTGGGTTGACAACAACCCAGATTCTTCGTGTAGTGAAGAAGCTTGATGAATCTGGAATGCTGGATTGTCTCCAG
TTATTGCATTTTCACATTGGATCTCAGATCCCCACAACAGAGTTGCTTGCTGATGGTGTTGGTGAGGCCACTCAGATTTACTCTGAATTA
GTCCGTCTTGGAGCTGGTATGAAATTCATTGATATCGGAGGGGGGCTTGGAATCGACTATGACGGTTCTAAATCAAGCAATTCTGATGTC
TCTGTTTGCTATAGCATTGAAGAATATGCCTCTGCTGTTGTCCAAGCGGTCCTCTATGTCTGTGATCGTAAGGGCGTAAAGCATCCAGTG
ATTTGCAGCGAAAGTGGCAGGGCAATTGTTTCTCACCATTCAATTCTGATTTTTGAAGCCGTGTCTGCTTCTACTAGTCATGTTTCTACA
CAGCCATCTTCGGGTGGTTTACAATCCTTGGTGGAGACTCTCAATGAAGATGCCCGTGCTGACTACAGAAACTTATCTGCTGCTGCTGTC
CGTGGAGAATATGATACATGTCTCATCTATTCTGATCAGTTGAAACAGAGATGTGTTGAACAGTTCAAAGATGGGTCCTTGGATATTGAG
CAGCTCGCTGCAGTGGATAGCATTTGTGATTGGGTGTCGAAGGCTATCGGGGTTGCTGATCCTGTCCGCACTTACCATGTGAATCTGTCA
GTTTTCACCTCAATCCCTGATTTTTGGGGCTTCAGCCAATTGTTTCCTATTGTTCCAATTCACCGTCTGGATGAAAAGCCTACAATGAGA
GGAATACTGTCTGACCTGACGTGTGACAGTGATGGAAAGGTTGATAAGTTCATTGGGGGCGAATCAAGCTTGCCGCTCCATGAAATTGGA
AGTGGTGATGGTGGGCGGTATTATCTGGGGATGTTTTTGGGTGGGGCTTATGAGGAGGCGCTCGGAGGACTCCACAATCTATTTGGTGGA
CCAAGCGTTGTTCGGGTGATGCAGAGCGATAGCCCTCACAGCTTTGCGGTGACTCGCTCTGTCCCTGGTCCATCGTGTGCTGATGTGCTC
CGGGCGATGCAGTTTGAGCCTGAACTCATGTTCGAGACTCTCAAGCACCGTGCAGAGGAATTCTTGGAACAAGGAGAAGGAGAAGGCGAA
GGTGTTGCCTTTGGATCTTTGACCAGCAGCTTAGCTCAGTCCTTCCACAACATGCCTTACCTTTCGTCTTGCTGCTTCACTGCAGAAGCC
ACTGCCAATGCCAATACCAATACCAATAATGGTGGCTATTACTATTACAGTGAAGACAATGCTGCAGCAGAGGAAGATGAGATTTGGTCC
TACTAA
Edits in Original Sequence 
GCTCATTTCATAAGCTGTTAGTTTCACGTTCTCTTCGCAATTTCCATTACAGCCGCTAGGTTTCCGTCCACTTCTTCTTCTCCATTAATA
TCTGTATGGTGTTCTTCTTTTTTGAATTCTAGATTTTTTCTTTGAATTCTTGTTAATCTTTAATTTTCTTTGTTTAAATCAAGAAATTAG
CTTCTTCTGAAGTCAGGGTGGGGATTTTTGGATCGTGTCAAAGTGTGTTAGAGGGTGATTATCTTTTGATTCACTTGTTTTTTTGCTTCT
TTTGAGGGGGTAGCCGGGGCCTCGGCCTCGGCGGGTTTTAATAGCCCCCAACTATTACAACATTGGGAAGAAGAACATCAATCTGTACAA
ACCCTTAAGTTAGTTTTTCTTTTTAATTCTTTGATTCTTTCTTCTTAACAAATCAAAACAGATCGGGGAAGAG
(5')ATGCCGGCCTTAG
GTTGTTGTGTAGACGCTTCTGTTTCCCCTCCTCTCGGCTATGCCTTTTCTTGGGATAGCTCTCTTCCCGCGCCGGAGTTGTTTTCCTCCG
GCGTACCTCCGGCGACAAACGCCGCCGCCGTTTCCACCGGTTCTCATTGGTCTACGGATCTGTCATCTGATTTGTACCGGGTAGATGGGT
GGGGTGCTCCTTATTTCTCCGTGAACTCTTCCGGGGATATTTCCGTCCGTCCACATGGTACGGATACTCTTCCTCACCAGGAGATTGACC
TTCTTAAGGTTGTGAAGAAGGCTTCTGACCCGAAAAATTTGGGTGGACTTGGGCTCCAGATGCCTCTTGTTGTCCGTTTTCCTGATGTTC
TGAAGAACCGTTTGGAGACTCTGCAATCGGCTTTTGACATGGCGATTAATTCTCAAGGCTATGAGGCTCACTATCAAGGTGTTTATCCGG
TGAAATGCAATCAAGATAGGTTCGTGGTGGAGGATATCGTGAAATTCGGGTCGCCATACCGATTCGGGCTGGAAGCCGGGTCTAAACCGG
AGCTCCTGTTGGCGATGAACTGTCTGTCAAAGGGCAGTGCTGATGCTCTTCTTGTTTGCAATGGTTTCAAGGACACTGAGTATATTTCGC
TTGCTTTGGTCGCAAGAAAGCTCCTTTTGAACAGTGTGATTGTGCTTGAACAAGAGGAGGAGCTTGACCTGGTGATTGATATCAGCCGTA
AGATGTCTGTCCGGCCTGTAATTGGACTTCGTGCTAAGCTCAGGACAAAGCATTCTGGCCATTTTGGATCCACTTCTGGTGAAAAGGGTA
AGTTTGGGTTGACAACAACCCAGATTCTTCGTGTAGTGAAGAAGCTTGATGAATCTGGAATGCTGGATTGTCTCCAGTTATTGCATTTTC
ACATTGGATCTCAGATCCCCACAACAGAGTTGCTTGCTGATGGTGTTGGTGAGGCCACTCAGATTTACTCTGAATTAGTCCGTCTTGGAG
CTGGTATGAAATTCATTGATATCGGAGGGGGGCTTGGAATCGACTATGACGGTTCTAAATCAAGCAATTCTGATGTCTCTGTTTGCTATA
GCATTGAAGAATATGCCTCTGCTGTTGTCCAAGCGGTCCTCTATGTCTGTGATCGTAAGGGCGTAAAGCATCCAGTGATTTGCAGCGAAA
GTGGCAGGGCAATTGTTTCTCACCATTCAATTCTGATTTTTGAAGCCGTGTCTGCTTCTACTAGTCATGTTTCTACACAGCCATCTTCGG
GTGGTTTACAATCCTTGGTGGAGACTCTCAATGAAGATGCCCGTGCTGACTACAGAAACTTATCTGCTGCTGCTGTCCGTGGAGAATATG
ATACATGTCTCATCTATTCTGATCAGTTGAAACAGAGATGTGTTGAACAGTTCAAAGATGGGTCCTTGGATATTGAGCAGCTCGCTGCAG
TGGATAGCATTTGTGATTGGGTGTCGAAGGCTATCGGGGTTGCTGATCCTGTCCGCACTTACCATGTGAATCTGTCAGTTTTCACCTCAA
TCCCTGATTTTTGGGGCTTCAGCCAATTGTTTCCTATTGTTCCAATTCACCGTCTGGATGAAAAGCCTACAATGAGAGGAATACTGTCTG
ACCTGACGTGTGACAGTGATGGAAAGGTTGATAAGTTCATTGGGGGCGAATCAAGCTTGCCGCTCCATGAAATTGGAAGTGGTGATGGTG
GGCGGTATTATCTGGGGATGTTTTTGGGTGGGGCTTATGAGGAGGCGCTCGGAGGACTCCACAATCTATTTGGTGGACCAAGCGTTGTTC
GGGTGATGCAGAGCGATAGCCCTCACAGCTTTGCGGTGACTCGCTCTGTCCCTGGTCCATCGTGTGCTGATGTGCTCCGGGCGATGCAGT
TTGAGCCTGAACTCATGTTCGAGACTCTCAAGCACCGTGCAGAGGAATTCTTGGAACAAGGAGAAGGAGAAGGCGAAGGTGTTGCCTTTG
GATCTTTGACCAGCAGCTTAGCTCAGTCCTTCCACAACATGCCTTACCTTTCGTCTTGCTGCTTCACTGCAGAAGCCACTGCCAATGCCA
ATACCAATACCAATAATGGTGGCTATTACTATTACAGTGAAGACAATGCTGCAGCAGAGGAAGATGAGATTTGGTCCTACTAA(3')ACT
CTGCTTGAAGTGTCTCTTGTTAGCATCTCCAGTTTGTTTTAGTTTGTGGTCGAGGTCGTCTGTTTTTTTATAATAATCCCACCCCTTAGT
TTGGGTGCATGTTAATTACTTTTGTTTGCAATAGATGCAGTAGACTGTCATCTCCTATTGCAACTAAGCTTATGTTATGACCGCAATCAG
TTTTATATTAATGCTGTCTTTTTTTGTTTCAAGTAAAAAAAAAAAAAAAAAACTCGAACAAGCTCCAGCAAAAACAGTGACCAACAAGAC
CTCGCTACAGTTGCTGCTCCGATCAGGAATTGGGAAGCAAATCAAAGATAAGACGGATCTCTCAGATCCTCCCTAGACATTTTACA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan