ESTScan Details for Unigene SGN-U578052

Score 
474
Direction 
Forward
Predicted Peptide Sequence 
XNNEYLVQRSNNSLIYKVGQQYKDQQFFDXGLSIFREIVKGGYYVGADPTLEEVMAPKQPNTGISVGLNKGHVVTKKELAPRPSDRKGKT
SKRIHFVRSLIREVAGFAPYEKRITELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSSVLRKMRATGGGEKKKXRPVSITTDXLKDPVV
NSPAFTCAMYFCFQERGLVIEKFPVYVDEYFGISDSLDIFANCVLFWX
Predicted Coding Sequence 
XGGAACAACGAGTATCTTGTTCAAAGGTCTAATAATTCACTAATCTATAAAGTTGGACAACAATACAAAGATCAACAGTTCTTTGATXTT
GGTTTAAGCATTTTCAGAGAAATAGTAAAAGGGGGCTATTACGTCGGAGCAGATCCAACACTTGAAGAGGTGATGGCTCCAAAGCAGCCG
AATACAGGGATATCTGTTGGTCTAAACAAAGGCCATGTTGTGACCAAGAAGGAATTAGCTCCACGCCCTTCTGACAGAAAAGGGAAAACA
AGCAAAAGAATACACTTTGTGAGGAGTCTTATCAGAGAAGTTGCTGGATTTGCTCCATATGAGAAGAGGATCACTGAGCTTCTCAAAGTT
GGAAAGGACAAGCGTGCCTTGAAGGTAGCCAAGAGGAAGTTGGGTACTCACAAGAGGGCAAAGAGGAAGAGAGAAGAGATGTCTAGTGTT
CTCCGCAAGATGAGGGCTACTGGAGGTGGTGAAAAGAAGAAGXTGAGGCCTGTATCCATCACTACTGATGXTTTGAAGGACCCAGTTGTT
AATTCACCAGCTTTTACGTGTGCAATGTATTTTTGTTTTCAAGAAAGAGGACTTGTGATCGAAAAGTTCCCTGTTTATGTTGATGAATAT
TTTGGAATTAGTGATTCTTTAGACATTTTTGCAAATTGCGTGCTTTTCTGGTXX
Edits in Original Sequence 
(5')XGGAACAACGAGTATCTTGTTCAAAGGTCTAtATAATTCACTAATCTATAAAGTTGGACAACAtATACAAAGATCAACAGTTCTTT
GATXTTGGTTTAAGCATTTTCAGAGAAATAGTAAAAGGGGGCTATTACGTCGGAGCAGATCCAACACaTTGAAGAGGTGATGGCTCCAAA
GCAGCCGAATACAGGGATATCTGTTGGTCTAAACAAAGGCCATGTTGTGACCAAGAAGGAATTAGCTCCACGCCCTTCTGACAGAAAAGG
GAAAACAAGCAAAAGAATACACTTTGTGAGGAGTCTTATCAGAGAAGTTGCTGGATTTGCTCCATATGAGAAGAGGATCACTGAGCTTCT
CAAAGTTGGAAAGGACAAGCGTGCCTTGAAGGTAGCCAAGAGGAAGTTGGGTACTCACAAGAGGGCAAAGAGGAAGAGAGAAGAGATGTC
TAGTGTTCTCCGCAAGATGAGGGCTACTGGAGGTGGTGAAAAGAAGAAGXTGAGGCCTGTATCCATCACTACTGATGXTTTGAAGGACCC
AGTTaGTTAATTCACCAGCTTTTACGTGTGCAATGTATTTTTGTTTTCAAGAAAGAGGACTTGTGATCGAAAAGTTCCCTGTTTATGTTc
GATGAATATTTTGGAATTAGTGATTCTTTAGACATTTTTGCAAATTGCGTGCTTTTCTGGTXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan