Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U578104

Score 
1778
Direction 
Forward
Predicted Peptide Sequence 
EVEMDRKNPFENEYYMRGPIXFAAKDIILLTPPLLTSSPISFKSQSSLLSFSAMASISAAAATATSSPKLLNPSNPLLPSAAKPSKLILS
SSFTPNFSTLLLHSPAATSPTTHHQRRFTVRAARGKFERKKPHVNIGTIGHVDHGKTTLTAALTMALASMGNSAPKKYDEIDAAPEERAR
GITINTATVEYETENRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSGADGPMPQTKEHILLAKQVGVPNMVVFLNKQDQVDDEELLEL
VELEVRELLSSYEFPGDDIPIVSGSALLALEALMANPSIKRGENEWVDKIFTLMDNVDSYIPIPQRQTELPFLMAIEDVFSITGRGTVAT
GRVERGTVRVGETVDIVGLRDTRSTTVTGVEMFQKILDEAMAGDNVGLLLRGIQKIDIQRGMVLAKPGTITPHTKFEALVYVLKKEEGGR
HSPFFSGYRPQFYMRTTDVTGKVTSITTDKGDESKMVMPGDRVNLVVELIMPVACEQGMRFAIREGGKTVGAGVIQKILE*
Predicted Coding Sequence 
GAGGTAGAAATGGATAGAAAAAATCCCTTTGAAAATGAGTACTATATGAGAGGCCCTATTXTTTTTGCTGCCAAGGATATAATACTGTTA
ACTCCTCCTCTTCTCACTTCTTCCCCAATTTCTTTCAAATCCCAATCCTCACTCTTATCCTTCTCCGCCATGGCTTCAATTTCAGCAGCG
GCTGCCACCGCCACTTCTTCTCCTAAGCTCCTAAACCCTTCTAATCCCCTTCTTCCTTCCGCTGCTAAACCATCTAAGCTTATCCTATCC
TCTTCATTTACCCCCAACTTTTCTACCCTTCTCCTCCACTCACCCGCCGCTACTTCTCCCACTACCCACCACCAACGCCGCTTCACTGTC
CGTGCTGCCCGTGGCAAATTCGAGAGGAAGAAACCCCATGTCAATATTGGCACTATTGGTCATGTTGACCATGGAAAGACTACCCTTACT
GCTGCTTTAACCATGGCTCTTGCTTCTATGGGTAATTCCGCTCCCAAGAAGTATGATGAAATTGATGCCGCCCCAGAAGAGCGTGCTCGT
GGGATTACTATTAATACGGCTACGGTTGAGTATGAGACTGAGAACCGACACTATGCCCACGTGGACTGCCCCGGTCACGCTGATTATGTC
AAGAACATGATTACTGGTGCTGCCCAGATGGATGGAGCTATTCTTGTTGTTTCCGGTGCTGATGGCCCAATGCCACAGACCAAAGAACAT
ATCTTGCTTGCTAAACAAGTGGGTGTTCCTAATATGGTGGTGTTTTTGAACAAACAAGATCAGGTTGATGATGAAGAGCTTCTTGAGCTT
GTTGAGTTGGAGGTAAGAGAGCTTTTGTCTAGTTATGAGTTCCCTGGTGATGATATTCCTATTGTTTCTGGCTCTGCTCTTTTGGCTTTA
GAGGCTTTAATGGCAAATCCTAGTATTAAGAGAGGTGAAAATGAATGGGTTGATAAGATTTTTACATTAATGGACAATGTTGATAGTTAT
ATTCCTATTCCGCAAAGACAAACTGAGTTGCCTTTTTTGATGGCTATTGAAGATGTGTTTTCAATCACTGGTAGAGGTACAGTGGCAACA
GGGAGAGTAGAGAGAGGGACTGTTAGGGTTGGAGAGACCGTTGATATTGTAGGATTAAGAGACACCAGGTCTACTACCGTGACCGGGGTT
GAAATGTTTCAGAAGATTTTGGATGAAGCAATGGCTGGTGATAATGTGGGATTGTTGTTGAGAGGTATTCAGAAGATTGATATTCAAAGA
GGAATGGTGTTGGCGAAACCGGGAACAATCACTCCTCACACCAAGTTTGAAGCTCTTGTGTATGTTCTGAAAAAGGAGGAGGGTGGCAGG
CATTCCCCATTCTTTTCGGGGTATAGGCCTCAGTTTTACATGAGGACCACCGATGTAACTGGGAAGGTTACTTCCATTACCACTGACAAA
GGGGATGAATCTAAGATGGTCATGCCTGGTGATCGTGTGAACTTGGTGGTTGAGCTCATTATGCCTGTCGCTTGTGAACAAGGGATGAGA
TTTGCCATCAGGGAAGGAGGAAAGACTGTTGGAGCTGGTGTCATTCAGAAAATTCTTGAGTGA
Edits in Original Sequence 
(5')GAGGTAGAAATGGATAGAAAAAATCCCTTTGAAAATGAGTACTATATGAGAGGCCCTATTXTTTTTGCTGCCAAGGATATAATACT
GTTAACTCCTCCTCTTCTCACTTCTTCCCCAATTTCTTTCAAATCCCAATCCTCACTCTTATCCTTCTCCGCCATGGCTTCAATTTCAGC
AGCGGCTGCCACCGCCACTTCTTCTCCTAAGCTCCTAAACCCTTCTAATCCCCTTCTTCCTTCCGCTGCTAAACCATCTAAGCTTATCCT
ATCCTCTTCATTTACCCCCAACTTTTCTACCCTTCTCCTCCACTCACCCGCCGCTACTTCTCCCACTACCCACCACCAACGCCGCTTCAC
TGTCCGTGCTGCCCGTGGCAAATTCGAGAGGAAGAAACCCCATGTCAATATTGGCACTATTGGTCATGTTGACCATGGAAAGACTACCCT
TACTGCTGCTTTAACCATGGCTCTTGCTTCTATGGGTAATTCCGCTCCCAAGAAGTATGATGAAATTGATGCCGCCCCAGAAGAGCGTGC
TCGTGGGATTACTATTAATACGGCTACGGTTGAGTATGAGACTGAGAACCGACACTATGCCCACGTGGACTGCCCCGGTCACGCTGATTA
TGTCAAGAACATGATTACTGGTGCTGCCCAGATGGATGGAGCTATTCTTGTTGTTTCCGGTGCTGATGGCCCAATGCCACAGACCAAAGA
ACATATCTTGCTTGCTAAACAAGTGGGTGTTCCTAATATGGTGGTGTTTTTGAACAAACAAGATCAGGTTGATGATGAAGAGCTTCTTGA
GCTTGTTGAGTTGGAGGTAAGAGAGCTTTTGTCTAGTTATGAGTTCCCTGGTGATGATATTCCTATTGTTTCTGGCTCTGCTCTTTTGGC
TTTAGAGGCTTTAATGGCAAATCCTAGTATTAAGAGAGGTGAAAATGAATGGGTTGATAAGATTTTTACATTAATGGACAATGTTGATAG
TTATATTCCTATTCCGCAAAGACAAACTGAGTTGCCTTTTTTGATGGCTATTGAAGATGTGTTTTCAATCACTGGTAGAGGTACAGTGGC
AACAGGGAGAGTAGAGAGAGGGACTGTTAGGGTTGGAGAGACCGTTGATATTGTAGGATTAAGAGACACCAGGTCTACTACCGTGACCGG
GGTTGAAATGTTTCAGAAGATTTTGGATGAAGCAATGGCTGGTGATAATGTGGGATTGTTGTTGAGAGGTATTCAGAAGATTGATATTCA
AAGAGGAATGGTGTTGGCGAAACCGGGAACAATCACTCCTCACACCAAGTTTGAAGCTCTTGTGTATGTTCTGAAAAAGGAGGAGGGTGG
CAGGCATTCCCCATTCTTTTCGGGGTATAGGCCTCAGTTTTACATGAGGACCACCGATGTAACTGGGAAGGTTACTTCCATTACCACTGA
CAAAGGGGATGAATCTAAGATGGTCATGCCTGGTGATCGTGTGAACTTGGTGGTTGAGCTCATTATGCCTGTCGCTTGTGAACAAGGGAT
GAGATTTGCCATCAGGGAAGGAGGAAAGACTGTTGGAGCTGGTGTCATTCAGAAAATTCTTGAGTGA(3')TCAACGAGCAGCAGCGCAT
TTCCATTCAAAATGGTCCGGTCCTTGTCATGCAATATTTTTAATCCCTTGTCATATATGCAACGTTTTGGTTACTTCTTTTCTTTTAGAT
CATAGGTTAGTTGGAGAAATCTTGTTATAAGTCAATGCTAGTGCACCTTTGCGAGTTTGCTTCAATTTTTGTTTGTTTGTTTGAAAAGAA
GAACATTTTGTATCTTGTGTATGTTTAGTTTCCATCAGGAAAAATCATACTTTTGATTGAAACTCAACTTAAACATGCCAATGAAATTAG
GTGCATTTGAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan