ESTScan Details for Unigene SGN-U578246

Score 
413
Direction 
Forward
Predicted Peptide Sequence 
MASSIVSSAAAATRSNVAQASMVAPFTGLKSAASFPVTKKNNNVDITSLASNGGRVRCMQVWPPINMKKYETLSYLPDLSDEQLLSEIEY
LLKNGWVPCLEFETERGFVYRENNSSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAWVRIIGFDNVRQVQCISFIAYKPEG
F*
Predicted Coding Sequence 
ATGGCTTCCTCAATTGTCTCATCGGCAGCCGCTGCTACCCGTAGCAATGTTGCTCAAGCTAGCATGGTCGCACCCTTCACCGGACTCAAA
TCCGCCGCTTCTTTTCCCGTTACCAAGAAGAACAACAACGTTGACATTACCTCCCTTGCTAGCAATGGTGGACGCGTTAGATGCATGCAG
GTGTGGCCACCAATCAACATGAAGAAATACGAGACATTGTCATACCTTCCTGACTTGTCCGATGAGCAATTGCTTAGCGAAATTGAGTAT
CTTTTGAAAAATGGATGGGTTCCTTGCTTGGAATTCGAGACTGAGCGCGGATTTGTGTACCGAGAGAACAACAGTTCCCCTGGATACTAC
GATGGTAGATACTGGACCATGTGGAAGTTACCTATGTTTGGGTGCACTGATGCAACACAGGTGTTGGCTGAGGTTCAAGAGGCGAAGAAG
GCGTACCCACAAGCCTGGGTTCGTATTATCGGATTCGACAACGTTCGTCAAGTCCAGTGCATCAGCTTCATTGCCTACAAGCCAGAAGGA
TTCTAA
Edits in Original Sequence 
TTTTTTAGTAAAGAAACAAATATCATTAATATAGTTCTTGTAAACTTGATTGAAATTCGAATTAATCATACAAAATATAGTTTCTTTGAA
ATTAAAAAAAAAAAAAACATTTTATAGCTAAGTAAGTAAACGCA
(5')ATGGCTTCCTCAATTGTCTCATCGGCAGCCGCTGCTACCCGT
AGCAATGTTGCTCAAGCTAGCATGGTCGCACCCTTCACCGGACTCAAATCCGCCGCTTCTTTTCCCGTTACCAAGAAGAACAACAACGTT
GACATTACCTCCCTTGCTAGCAATGGTGGACGCGTTAGATGCATGCAGGTGTGGCCACCAATCAACATGAAGAAATACGAGACATTGTCA
TACCTTCCTGACTTGTCCGATGAGCAATTGCTTAGCGAAATTGAGTATCTTTTGAAAAATGGATGGGTTCCTTGCTTGGAATTCGAGACT
GAGCGCGGATTTGTGTACCGAGAGAACAACAGTTCCCCTGGATACTACGATGGTAGATACTGGACCATGTGGAAGTTACCTATGTTTGGG
TGCACTGATGCAACACAGGTGTTGGCTGAGGTTCAAGAGGCGAAGAAGGCGTACCCACAAGCCTGGGTTCGTATTATCGGATTCGACAAC
GTTCGTCAAGTCCAGTGCATCAGCTTCATTGCCTACAAGCCAGAAGGATTCTAA(3')ATTTCCAAACATATAATCAAAATGTTTGTTTG
ATTTGTACCTAAGTCTTTAATTTTTTTTCTTCAATTTTTGTTTTGCATTTTGTTCCTATTTGTACCGGTGTATTTTCTTCGATTCCGACC
AAGTTATGAGAAATTAATAATGATGAATCGGTGGTTATATGTTTAATCAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan