ESTScan Details for Unigene SGN-U578345

Score 
1136
Direction 
Forward
Predicted Peptide Sequence 
XSILPPPPETVTTAVHGGEKGAYSSPPQQQNKVQIFNMGQGFSCGTSDEHGLFTAVQCGDLETVKALFERNPSLVHHSTVYDRQSALHIA
AANGQIEVVSMLLDMSVKPDLLNRYKQTPLMLAAMHGKISCVQKLIEAGANILMFDSLNGRTCLHYAAYYGYSDCLKTILFAARTSHIAS
SWGYARFVNVNDGKGATPLHLAARQRRADCVHILLDNGALACASTDGYGFPGSTPLHLAARAGSLDCIRELLAWGAERLQRDDLGRIPYT
IALRYKHGACAALLNPSSAEPLVWPSPLKFISELNKEAKHLLECALMEANKEREKNILKGTTYSPPSPTNSDNEMDDNISEVNEKKFVVY
ASIKYAQFRSRTAGTRCVHIVYWRYAXHKKPNPTTTSPIVPVCPFCRSNIVQLDVIKLEKDDGTSHDIVSPSKLRKFRRSRNFSEGSSSF
KGLFAVSSFGRMVGRGFGRIAAENEYIDKPIILD*
Predicted Coding Sequence 
XXTTCAATTCTCCCACCACCACCAGAAACCGTCACCACCGCCGTCCACGGTGGTGAAAAAGGGGCTTACTCATCGCCGCCGCAGCAGCAG
AATAAAGTTCAGATTTTTAATATGGGTCAGGGGTTCAGTTGTGGAACAAGTGATGAACACGGATTGTTTACTGCTGTTCAGTGTGGTGAT
TTGGAGACTGTAAAGGCTCTGTTTGAGAGAAACCCAAGTCTTGTTCATCATTCTACAGTTTATGATCGACAGTCTGCTTTACATATTGCT
GCTGCCAATGGCCAAATTGAGGTTGTTTCTATGCTTTTAGACATGTCTGTTAAGCCTGATTTATTGAATCGGTATAAGCAGACTCCATTG
ATGCTAGCAGCAATGCACGGGAAGATCTCTTGTGTGCAAAAGCTTATTGAAGCCGGGGCCAATATTTTGATGTTTGATTCATTGAATGGG
AGGACATGCTTGCACTATGCGGCCTATTATGGGTACTCTGATTGTCTCAAAACAATTCTTTTTGCTGCTCGGACATCACACATTGCGTCT
TCTTGGGGATATGCCCGGTTTGTGAACGTTAATGATGGTAAAGGAGCAACACCTTTGCACTTAGCAGCTCGTCAAAGACGGGCTGATTGT
GTTCATATTTTACTAGACAATGGTGCTCTTGCTTGTGCTTCTACCGATGGATATGGTTTCCCAGGTAGTACACCACTTCATTTGGCTGCA
AGAGCTGGTTCTCTTGATTGTATCCGTGAATTGTTAGCATGGGGAGCAGAGCGATTACAAAGAGATGATTTGGGGAGAATACCATACACA
ATTGCTTTAAGATACAAACATGGTGCATGTGCAGCGTTGCTGAATCCTTCATCTGCAGAGCCTCTTGTATGGCCATCGCCATTGAAGTTC
ATCAGTGAGCTGAATAAAGAGGCAAAACATTTGCTAGAATGTGCACTCATGGAGGCTAACAAGGAGAGGGAAAAGAACATCCTGAAAGGA
ACAACTTATTCGCCACCATCGCCAACCAATTCCGATAATGAGATGGATGACAATATCTCTGAGGTCAATGAAAAGAAATTTGTTGTATAT
GCTTCGATCAAGTATGCACAATTCAGGTCCAGGACTGCGGGCACCAGATGTGTGCACATTGTGTACTGGCGTTATGCTGXTCATAAAAAG
CCTAATCCTACTACTACCAGTCCTATTGTACCTGTGTGCCCATTCTGTCGTAGCAACATTGTTCAATTAGATGTTATCAAGCTGGAAAAG
GACGATGGGACTAGCCACGATATTGTTTCCCCTTCAAAGCTTAGGAAGTTTAGGCGATCAAGAAACTTCAGCGAGGGGAGTAGCAGTTTT
AAGGGCTTATTTGCAGTAAGCTCTTTTGGAAGAATGGTTGGTCGTGGCTTTGGTAGAATTGCTGCTGAAAACGAATACATTGATAAGCCA
ATAATCCTTGACTAA
Edits in Original Sequence 
(5')XXTTCAATTCTCCCACCACCACCAGAAACCGTCACCACCGCCGTCCACGGTGGTGAAAAAGGGGCTTACTCATCGCCGCCGCAGCA
GCAGAATAAAGTTCAGATTTTTAATATGGGTCAGGGGTTCAGTTGTGGAACAAGTGATGAACACGGATTGTTTACTGCTGTTCAGTGTGG
TGATTTGGAGACTGTAAAGGCTCTGTTTGAGAGAAACCCAAGTCTTGTTCATCATTCTACAGTTTATGATCGACAGTCTGCTTTACATAT
TGCTGCTGCCAATGGCCAAATTGAGGTTGTTTCTATGCTTTTAGACATGTCTGTTAAGCCTGATTTATTGAATCGGTATAAGCAGACTCC
ATTGATGCTAGCAGCAATGCACGGGAAGATCTCTTGTGTGCAAAAGCTTATTGAAGCCGGGGCCAATATTTTGATGTTTGATTCATTGAA
TGGGAGGACATGCTTGCACTATGCGGCCTATTATGGGTACTCTGATTGTCTCAAAACAATTCTTTTTGCTGCTCGGACATCACACATTGC
GTCTTCTTGGGGATATGCCCGGTTTGTGAACGTTAATGATGGTAAAGGAGCAACACCTTTGCACTTAGCAGCTCGTCAAAGACGGGCTGA
TTGTGTTCATATTTTACTAGACAATGGTGCTCTTGCTTGTGCTTCTACCGATGGATATGGTTTCCCAGGTAGTACACCACTTCATTTGGC
TGCAAGAGCTGGTTCTCTTGATTGTATCCGTGAATTGTTAGCATGGGGAGCAGAGCGATTACAAAGAGATGATTTGGGGAGAATACCATA
CACAATTGCTTTAAGATACAAACATGGTGCATGTGCAGCGTTGCTGAATCCTTCATCTGCAGAGCCTCTTGTATGGCCATCGCCATTGAA
GTTCATCAGTGAGCTGAATAAAGAGGCAAAACATTTGCTAGAATGTGCACTCATGGAGGCTAACAAGGAGAGGGAAAAGAACATCCTGAA
AGGAACAACTTATTCGCCACCATCGCCAACCAATTCCGATAATGAGATGGATGACAATATCTCTGAGGTCAATGAAAcAGAAATTTGTTG
TATATGCTTCGATCAAGTATGCACAATTCAGGTCCAGGACTGCGGGCACCAGATGTGTGCACATTGTGTACTGGCGTTATGCTGXTCATA
AAAAGCCTAATCCTACTACTACCAGTCCTATTGTACCTGTGTGCCCATTCTGTCGTAGCAACATTGTTCAATTAGATGTTATCAAGCTGG
AAAAGGACGATGGGACTAGCCACGATATTGTTTCCCCTTCAAAGCTTAGGAAGTTTAGGCGATCAAGAAACTTCAGCGAGGGGAGTAGCA
GTTTTAAGGGCTTATTTGCAGTAAGCTCTTTTGGAAGAATGGTTGGTCGTGGCTTTGGTAGAATTGCTGCTGAAAACGAATACATTGATA
AGCCAATAATCCTTGACTAA(3')TTGCAGAATTTTGCATCAAGACTTCCAATTAGCATGATTTTTTAAGAGCATCCTAAATGGTATATT
GTTACCACATTTTTTTACAGTTGAAATAGAAGGAATTCTTTGACAGTTGCCTCATTTTTTGTTCTGTTTTGTCCTGCCTGATGAAAATTC
AAAAAGGTCTCGATGTGTAATGTTAATATGAACAATCGCCTTAAAAAGATATGAAAGTTTAATAATGTGGAAGAAAAAAAAAAAAAAAAA
AA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan