ESTScan Details for Unigene SGN-U578365

Score 
339
Direction 
Forward
Predicted Peptide Sequence 
GMIGILVGSAAAIILALSLACCLVINIRGNDNERSESLASYDGMEESKHAEITIFDLTTITNATDQFSDANKLGEGGFGSVYKGHLTDGQ
VIAVKRLSVTSGQGTEEFKNEVTVIXKTSAQKFGEAFRMLRSTGEKMLVYEYMPNKSLDSFIFDLLFTNFQTGDLDKTKGSLLDWGKRFG
IIHGIARGMLYLHQDSRLRIIHRDLKASNVLLDASMQPKISDFGMXRIFGGXPMEATQIELLEHMXX
Predicted Coding Sequence 
GGAATGATAGGGATTCTAGTAGGGTCTGCTGCAGCAATAATTCTTGCACTCTCTTTGGCATGTTGTTTGGTGATCAATATAAGGGGAAAT
GATAATGAAAGAAGTGAAAGTTTAGCATCCTATGACGGCATGGAAGAAAGTAAACATGCAGAAATCACTATCTTTGATCTAACCACAATA
ACTAATGCCACTGATCAGTTCTCTGATGCTAACAAACTTGGTGAAGGAGGATTTGGTAGCGTATACAAGGGTCACCTGACAGATGGACAA
GTAATAGCTGTCAAAAGACTTTCAGTAACTTCGGGGCAAGGGACGGAGGAGTTCAAGAATGAAGTCACAGTAATTGXCAAGACTTCAGCA
CAGAAATTTGGTGAGGCTTTTAGGATGTTGCGTTCAACAGGAGAGAAGATGTTGGTTTATGAATATATGCCAAACAAATCCTTGGACAGT
TTTATTTTTGATCTCTTATTCACCAACTTTCAAACXGGTGATCTAGATAAAACAAAAGGGTCTTTGTTGGATTGGGGAAAACGGTTTGGA
ATCATACATGGGATTGCACGAGGAATGTTATACCTTCACCAAGACTCTAGACTAAGAATTATTCATAGAGACCTAAAAGCAAGCAATGTT
TTACTCGATGCCTCCATGCAACCGAAAATATCAGACTTTGGAATGGNCAGAATATTTGGAGGTGXACCAATGGAAGCAACACAAATCGAG
TTGTTGGAACATATGGNTAXX
Edits in Original Sequence 
(5')GGAATGATAGGGATTCTAGTAGGGTCTGCTGCAGCAATAATTCTTGCACTCTCTTTGGCATGTTGTTTGGTGATCAATATAAGGGG
AAATGATAATGAAAGAAGTGAAAGTTTAGCATCCTATGACGGCATGGAAGAAAGTAAACATGCAGAAATCACTATCTTTGATCTAACCAC
AATAACTAATGCCACTGATCAGTTCTCTGATGCTAACAAACTTGGTGAAGGAGGATTTGGTAGCGTATACAAGGGTCACCTGACAGATGG
ACAAGTAATAGCTGTCAAAAGACTTTCAGTAACTTCGGGGCAAGGGACGGAGGAGTTCAAGAATGAAGTCACAGTAATTGXCAAGACTTC
AGCACAGAAATTTGGTGAGGCTTTTAGGATGTTGCGTTCAACgAGGAGAGAAGATGTTGGTTTATGAATATATGCCAAACAAATCCTTGG
ACAGTTTTATTTTTGATCTCTTATTCACCAACTTTCAAACXGGTGATCTAGATAAAACAAAAGGGTCTTTGTTGGATTGGGGAAAACGGT
TTGGAATCATACATGGGATTGCACGAGGAATGTTATACCTTCACCAAGACTCTAGACTAAGAATTATTCATAGAGACCTAAAAGCAAGCA
ATGTTTTACTCGATGCCTCCATGCAACCGAAAATATCAGACTTTGGAATGGNCAGAATATTTGGAGGTGXACCAATGGAAGCAACACAAA
TCGAGTTGTTGGAACATATGGNTAXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan