ESTScan Details for Unigene SGN-U578448

Score 
622
Direction 
Forward
Predicted Peptide Sequence 
XAIGGQSAEFPWGAELRNYSNXFTVQKKMESPRVEESYDKMSELKAFDDTKAGVKGLVDSGITKVPQIFVLPPKDRAKKCETHFVFPVID
LQGIDEDPIKHKEIVDKVRDASEKWGFFQVVNHGIPTSVLDRTLQGTRQFFEQDNEVKKQYYTRDTAKKVVYTSNLDLYKSSVPAASWRD
TIFCYMAPNPPSLQEFPTPCGESLIDFSKDVKKLGFTLLELLSEGLGLDRSYLKDYMDCFHLFCSCNYYPPCPQPELTMGTIQHTDIGFV
TILLQDDMGGLQVLHQNHWVDVPPTPGSLVVNIGDFLQLLSNDKYLSVEHRAISNNVGSRMSITCFFGESPYQSSKLYGPITELLSEDNP
PKYRANHSERPH*
Predicted Coding Sequence 
XXGGCGATTGGCGGCCAATCGGCCGAATTCCCATGGGGAGCCGAATTGAGAAATTATTCTAATXCATTCACAGTGCAAAAGAAGATGGAA
AGCCCTAGAGTTGAGGAGAGTTATGACAAAATGAGTGAATTAAAAGCGTTTGATGATACTAAGGCCGGTGTTAAAGGACTTGTTGATTCT
GGAATTACTAAAGTACCTCAAATATTCGTTCTACCGCCAAAAGACAGGGCTAAAAAATGTGAAACACATTTCGTTTTTCCAGTGATAGAC
CTTCAAGGTATCGATGAGGATCCGATTAAGCATAAGGAGATAGTGGACAAAGTTCGAGATGCATCGGAGAAATGGGGTTTTTTCCAAGTG
GTTAATCATGGGATTCCAACATCCGTCTTGGACAGAACGTTGCAAGGAACACGACAGTTCTTTGAGCAAGATAACGAGGTTAAGAAACAG
TATTACACTCGAGATACTGCGAAAAAAGTGGTTTATACTAGCAATCTTGATTTGTATAAATCTTCTGTTCCAGCTGCAAGTTGGAGAGAC
ACGATTTTCTGTTACATGGCTCCGAATCCTCCCAGTCTACAAGAATTTCCAACTCCATGCGGGGAGTCATTAATAGACTTCTCCAAGGAT
GTGAAGAAACTGGGATTCACTTTACTTGAATTATTGTCTGAAGGTCTCGGTCTCGATCGTAGTTATCTCAAAGATTATATGGATTGTTTT
CATCTTTTCTGTTCTTGCAACTACTACCCACCATGTCCTCAGCCAGAACTCACCATGGGCACCATTCAACATACCGATATTGGTTTTGTA
ACGATCCTTCTACAAGATGATATGGGAGGGCTCCAAGTTCTTCACCAGAATCATTGGGTTGATGTTCCTCCTACACCCGGTTCTCTAGTG
GTGAATATTGGAGATTTTCTGCAGCTCTTGTCAAATGACAAGTACTTAAGTGTCGAGCACAGAGCAATCTCAAACAATGTTGGATCAAGA
ATGTCAATCACGTGCTTCTTCGGTGAAAGTCCATATCAATCTTCCAAGCTTTATGGACCGATAACTGAATTGTTATCAGAAGATAATCCT
CCAAAATATCGCGCXAACCACAGTGAAAGACCACACTAG
Edits in Original Sequence 
(5')XXGGCGATTGGCGGCCAATCGGCCGAATTCCCATGGGGAGCCGAATTGAGAAATTATTCTAATXCATTCACAGTGCAAAAGAAGAT
GGAAAGCCCTAGAGTTGAGGAGAGTTATGACAAAATGAGTGAATTAAAAGCGTTTGATGATACTAAGGCCGGTGTTAAAGGACTTGTTGA
TTCTGGAATTACTAAAGTACCTCAAATATTCGTTCTACCGCCAAAAGACAGGGCTAAAAAATGTGAAACACATTTCGTTTTTCCAGTGAT
AGACCTTCAAGGTATCGATGAGGATCCGATTAAGCATAAGGAGATAGTGGACAAAGTTCGAGATGCATCGGAGAAATGGGGTTTTTTCCA
AGTGGTTAATCATGGGATTCCAACATCCGTCTTGGACAGAACGTTGCAAGGAACACGACAGTTCTTTGAGCAAGATAACGAGGTTAAGAA
ACAGTATTACACTCGAGATACTGCGAAAAAAGTGGTTTATACTAGCAATCTTGATTTGTATAAATCTTCTGTTCCAGCTGCAAGTTGGAG
AGACACGATTTTCTGTTACATGGCTCCGAATCCTCCCAGTCTACAAGAATTTCCAACTCCATGCGGGGAGTCATTAATAGACTTCTCCAA
GGATGTGAAGAAACTGGGATTCACTTTACTTGAATTATTGTCTGAAGGTCTCGGTCTCGATCGTAGTTATCTCAAAGATTATATGGATTG
TTTTCATCTTTTCTGTTCTTGCAACTACTACCCACCATGTCCTCAGCCAGAACTCACCATGGGCACCATTCAACATACCGATATTGGTTT
TGTAACGATCCTTCTACAAGATGATATGGGAGGGCTCCAAGTTCTTCACCAGAATCATTGGGTTGATGTTCCTCCTACACCCGGTTCTCT
AGTGGTGAATATTGGAGATTTTCTGCAGCTCTTGTCAAATGACAAGTACTTAAGTGTCGAGCACAGAGCAATCTCAAACAATGTTGGATC
AAGAATGTCAATCACGTGCTTCTTCGGTGAAAGTCCATATCAATCTTCCAAGCTTTATGGACCGATAACTGAATTGTTATCAGAAGATAA
TCCTCCAAAATATCGCGCXAACCACAGTGAAAGACCACACTAG(3')TTACCTCCATAACAGAGGCCTAGATGGAACTTCTGCATTGTCC
CGTTACAAGATCTAAGAATAAGAATAATAATGTTATCTATTATTACTATTTATACTTCTGCAGATTGTACCTTTGAATTTGAAGCAAATG
TTTGAGTTAAATACTTTCACGTTTCTAAGCAATGTAATATAATTTATAAAGTATGTGCTTGCTATATATTGTTGTTTAAAACATTAAATA
ATATTACATAAATATAAACACCATAATATAAGGATGTTTAGCATTGTGGGAAAAAAAAAAAAATTGCTGGTGCACACTAAGAAAACCTCG
CAGAAAAGTCATTCAATTATTTGACTTACGAAATCACTCTTCACTATTGTCATTACAGGT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan