ESTScan Details for Unigene SGN-U578490

Score 
446
Direction 
Forward
Predicted Peptide Sequence 
XHFGGKRSAEEKSALPEMVTYKFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFEKNPTT
IKNYGIWLRYQSRTGYHNMYKEYRDTTLNGGVEQMYIEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLVFKKVRPPSR
KLKTTYKATNPTCSCNLFGHMCIEKQLQIYAILVQ*
Predicted Coding Sequence 
XCTCACTTCGGCGGCAAACGCAGTGCAGAGGAAAAGAGTGCCTTGCCXGAAATGGTGACGTACAAGTTCCATCAGTATCAGGTTGTCGGG
AGAGCTTTGCCCACCGAAACAGATGAACATCCCAAGATTTATCGTATGAAGTTGTGGGCTACAAATGAAGTTCGTGCGAAGTCCAAATTC
TGGTATTTCTTGAGGAAGCTTAAGAAGGTGAAGAAGAGCAACGGTCAGATGCTGGCTATTAATGAGATCTTCGAGAAGAACCCAACAACA
ATTAAGAATTATGGTATTTGGCTCCGTTACCAGAGTAGAACGGGATACCACAACATGTACAAGGAGTACCGTGACACCACATTGAATGGT
GGTGTGGAGCAGATGTACATTGAGATGGCTTCTCGCCACAGAGTTCGCCATCACTGCATCCAGATCATAAAGACCGCAACCATTCCGGCT
AAGCTGTGCAAGAGGGAGAGCACAAAGCAGTTCCATGACTCCAAGATCAAGTTCCCCTTGGTGTTCAAGAAAGTCAGGCCACCATCTAGG
AAACTCAAGACCACATACAAGGCTACTAACCCAACTTGTTCATGTAACTTGTTTGGTCATATGTGCATTGAGAAGCAACTTCAGATTTAT
GCAATTTTGGTGCAGTAG
Edits in Original Sequence 
(5')XCTCACTTCGGCGGCAAACGCAGTGCAGAGGAAAAGAGTGCCTTGCCXGAAATGGTGACGTACAAGTTCCATCAGTATCAGGTTGT
CGGGAGAGCTTTGCCCACCGAAACAGATGAACATCCCAAGATTTATCGTATGAAGTTGTGGGCTACAAATGAAGTTCGTGCGAAGTCCAA
ATTCTGGTATTTCTTGAGGAAGCTTAAGAAGGTGAAGAAGAGCAACGGTCAGATGCTGGCTATTAATGAGATCTTCGAGAAGAACCCAAC
AACAATTAAGAATTATGGTATTTGGCTCCGTTACCAGAGTAGAACGGGATACCACAACATGTACAAGGAGTACCGTGACACCACATTGAA
TGGTGGTGTGGAGCAGATGTACATTGAGATGGCTTCTCGCCACAGAGTTCGCCATCACTGCATCCAGATCATAAAGACCGCAACCATTCC
GGCTAAGCTGTGCAAGAGGGAGAGCACAAAGCAGTTCCATGACTCCAAGATCAAGTTCCCCTTGGTGTTCAAGAAAGTCAGGCCACCATC
TAGGAAACTCAAGACCACATACAAGGCTACTAAgCCCAACTTGTTCATGTAACTTGTTTGGTCATATGTGCATTGAGAAGCAACTTCAGA
TTTATGCAATTTTGGTGCAGTAG(3')TTGAGTTGAGTTAAAGATTCATTGTGAAAGAGATATAAGTTAAACCTTTTTGTTCGACTGACC
AAATGATGGTGGTTATTAGAGTATTTTTAATCATGAATTCCTA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan