Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U578557

Score 
555
Direction 
Forward
Predicted Peptide Sequence 
XXXXXTAGXPMLFSFPFYDKRIKAAFDHXARLSVVADRKEEAPFASPMAAILARKSLSALLSRQLVLAGHTIEGTNGYSRTLLGTRSFAT
KHSFSTDKDDEEREQLAKELSKDWNSVFERSINTLFLTEMVRGLMLTLKYFFEKKVTINYPFEKGPLSPRFRGEHALRRYATGEERCIAC
KLCEAICPAQAITIEAEEREDGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFATETHEELLYDKEKLLENGDRWETEIAENLR
SESLYR*
Predicted Coding Sequence 
XGGNNNNNNNGCNTNACNGCCGGGGNNCCCATGTTATTTTCCTTCCCTTTTTATGACAAAAGAATAAAAGCAGCGTTTGACCATAXAGCT
CGTCTTTCAGTTGTTGCCGATCGCAAGGAAGAAGCXCCATTTGCATCTCCCATGGCTGCCATCTTAGCTCGCAAATCTCTATCTGCTTTA
CTTTCTCGTCAGCTTGTTTTGGCAGGACATACAATTGAAGGAACTAATGGCTACAGCAGAACTCTGCTTGGCACCCGATCATTTGCTACC
AAGCATTCGTTTTCTACTGACAAAGATGATGAAGAAAGAGAGCAGCTAGCAAAGGAGTTATCAAAAGATTGGAATTCAGTTTTTGAGCGA
AGCATCAATACATTATTTTTGACTGAAATGGTTCGAGGTTTAATGTTGACGCTGAAGTACTTCTTTGAGAAGAAAGTAACGATTAACTAT
CCATTTGAGAAGGGTCCTTTAAGTCCTCGTTTTCGTGGAGAACATGCTCTTAGGCGTTATGCAACTGGAGAGGAAAGATGCATTGCGTGT
AAACTTTGTGAAGCTATTTGCCCTGCCCAAGCCATCACCATCGAGGCCGAGGAGCGAGAGGATGGAAGTCGTCGCACAACTAGGTATGAT
ATTGACATGACAAAATGCATTTACTGTGGATTCTGCCAAGAAGCCTGCCCTGTTGATGCAATTGTTGAAGGACCCAACTTTGAATTTGCA
ACCGAAACTCATGAGGAACTTCTTTACGACAAGGAGAAGCTTCTCGAGAATGGTGATCGATGGGAAACTGAGATTGCCGAGAATCTGAGA
TCCGAAAGCCTCTACCGCTGA
Edits in Original Sequence 
(5')XGGNNNNNNNGCNTNACNGCCGGGGNNCCCATGTTATTTTCCTTCCCTTTTTATGACAAAAGAATAAAAcGCAGCGTTTGACCATA
XAGCTCGTCTTTCAGTTGTTGCCGATCGCAAGGAAGAAGCXCCATTTGCATCTCCCATGGCTGCCATCTTAGCTCGCAAATCTCTATCTG
CTTTACTTTCTCGTCAGCTTGTTTTGGCAGGACATACAATTGAAGGAACTAATGGCTACAGCAGAACTCTGCTTGGCACCCGATCATTTG
CTACCAAGCATTCGTTTTCTACTGACAAAGATGATGAAGAAAGAGAGCAGCTAGCAAAGGAGTTATCAAAAGATTGGAATTCAGTTTTTG
AGCGAAGCATCAATACATTATTTTTGACTGAAATGGTTCGAGGTTTAATGTTGACGCTGAAGTACTTCTTTGAGAAGAAAGTAACGATTA
ACTATCCATTTGAGAAGGGTCCTTTAAGTCCTCGTTTTCGTGGAGAACATGCTCTTAGGCGTTATGCAACTGGAGAGGAAAGATGCATTG
CGTGTAAACTTTGTGAAGCTATTTGCCCTGCCCAAGCCATCACCATCGAGGCCGAGGAGCGAGAGGATGGAAGTCGTCGCACAACTAGGT
ATGATATTGACATGACAAAATGCATTTACTGTGGATTCTGCCAAGAAGCCTGCCCTGTTGATGCAATTGTTGAAGGACCCAACTTTGAAT
TTGCAACCGAAACTCATGAGGAACTTCTTTACGACAAGGAGAAGCTTCTCGAGAATGGTGATCGATGGGAAACTGAGATTGCCGAGAATC
TGAGATCCGAAAGCCTCTACCGCTGA(3')GTAGTTTTGGTTAATTTTGAGTTTTGANACAATGAAANATTCTAGCTTCTGAGNACTANA
AAATNA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan