ESTScan Details for Unigene SGN-U578592

Score 
737
Direction 
Forward
Predicted Peptide Sequence 
ATSLPPLRRSLNLQRRFFPFYFXAMSKLQSDALREAITVIKNDSSEKKRKFTETIELQIGLKNYDPQKDKRFSGSVKLPHIPRPKMKICM
LGDAQHVGEAEKIGLEYMDVEGLKKLNKNKKLVKKLAKKYHAFLASEAVIKQIPRLLGPGLNKAGKFPTLVSHQESLESKVNETKATIKF
QLKKVLCMGVAVGNXGYGGETNLPERADECQLSRVLAKEELAKCEMLVLEEYHGKDSTHLLRTLYYNLCSFRRFDLYAL*
Predicted Coding Sequence 
GCAACTTCTTTGCCACCACTCCGCCGCTCACTCAATTTGCAGAGACGATTCTTCCCATTCTACTTTGXAGCCATGAGTAAGCTTCAGAGT
GATGCCTTAAGAGAAGCCATCACCGTGATTAAGAATGATTCAAGTGAGAAGAAAAGGAAGTTCACCGAAACCATTGAGCTTCAGATTGGT
TTGAAAAACTATGATCCTCAAAAGGACAAGCGTTTCAGTGGTTCAGTTAAGTTGCCACACATTCCTCGCCCCAAGATGAAGATTTGCATG
CTTGGAGATGCTCAGCACGTGGGAGAGGCAGAAAAGATTGGTTTGGAGTACATGGATGTGGAAGGTCTGAAGAAGCTTAATAAAAACAAG
AAGTTGGTTAAGAAGCTCGCAAAGAAGTACCATGCTTTCTTGGCATCAGAAGCTGTTATCAAGCAGATCCCCCGTCTCTTGGGGCCTGGT
TTGAACAAGGCAGGTAAGTTTCCTACCCTTGTTTCCCACCAGGAATCACTCGAGTCTAAGGTAAACGAGACCAAGGCGACTATCAAATTC
CAGTTGAAGAAGGTTCTTTGCATGGGAGTTGCCGTAGGTAATXATGGATATGGAGGAGAAACAAATCTTCCAGAACGTGCAGATGAGTGT
CAACTTTCTCGTGTCCTTGCTAAAGAAGAATTGGCAAAATGTGAGATGCTTGTACTTGAAGAGTACCATGGGAAAGACTCAACGCATCTT
CTAAGGACATTGTATTACAATCTTTGCAGTTTCAGGCGTTTTGACTTGTACGCGTTATAG
Edits in Original Sequence 
(5')GCAACTTCTTTGCCACCACTCCGCCGCTCACTCAATTTGCAGAGACGATTCTTCCCATTCTACTTTGXAGCCATGAGTAAGCTTCA
GAGTGATGCCTTAAGAGAAGCCATCACCGTGATTAAGAATGATTCAAGTGAGAAGAAAAGGAAGTTCACCGAAACCATTGAGCTTCAGAT
TGGTTTGAAAAACTATGATCCTCAAAAGGACAAGCGTTTCAGTGGTTCAGTTAAGTTGCCACACATTCCTCGCCCCAAGATGAAGATTTG
CATGCTTGGAGATGCTCAGCACGTGGGAGAGGCAGAAAAGATTGGTTTGGAGTACATGGATGTGGAAGGTCTGAAGAAGCTTAATAAAAA
CAAGAAGTTGGTTAAGAAGCTCGCAAAGAAGTACCATGCTTTCTTGGCATCAGAAGCTGTTATCAAGCAGATCCCCCGTCTCTTGGGGCC
TGGTTTGAACAAGGCAGGTAAGTTTCCTACCCTTGTTTCCCACCAGGAATCACTCGAGTCTAAGGTAAACGAGACCAAGGCGACTATCAA
ATTCCAGTTGAAGAAGGTTCTTTGCATGGGAGTTGCCGTAGGTAATXATGGATATGGAGGAGAAACAAATCTTCCAGAACGTGCAGATGA
GTGTCAACTTTCTCGTGTCCTTGCTAAAGAAGAATTGGCAAAATGTGAGATGCTTGTACTTGAAGAGTACCATGGGAAAGACTCAACGCA
TCTTCTAAGGACATTGTATTACAATCTTTGCAGTTTCAGGCGTTTTGACTTGTACGCGTTATAG(3')ATACTATTGCATTTTTTGTTTA
GTTGTGCTCCTTGGATACTGAGTTGAAAACTTTATATCAGTTTTGTTATGATTTTACTTTTTCTTTTCTCCTTTCTGTTGATTTTCTTGA
ATATTGTCAACTTTCATATCTAAAGGAAAACTCAAATTTTGTGGTTTAAAAAAAAAAAAAAAAAACTGAGAGAAGTTGAGGCAAGTTCAT
TTGGAGGATGAAAAGTTGGTTCAAGAATTTATCTTGGGTAATTATGATGCTGTGGCTACCGCAGCTTATCATCAGAAGCACTCAGATAGT
TCAGTACTAAAGGATCCCCGTTCGAAAGATGCATCACAAAGATATCATGCTCATATATATACTAATGGAACCATGTGTGATTTAACACAT
GAGCCACGACAGACAGAGGTGAGGTTTGTTTGCTCACAGCCT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan