ESTScan Details for Unigene SGN-U578645

Score 
772
Direction 
Forward
Predicted Peptide Sequence 
MGXYDGRDAVEAMAKEAKRNDLILRSSGTVNVDGSKNFASLFSRRGEKGVNQDCFIVWEEFGCQEDMTFCGIFDGHGPWGHFVSKKVRES
IVSSLLCIWQESLAEASADPDLDKKAQRFNIWKESFLKACATVDQELEHHPKIDTFYSGTTALTIVRQGEVLFIANVGDSRAVLATTCDD
GNLVPVQLTVDFKPNLPQETERILQCNGRVFCLDDESGVHRLWLPDESSPGLAMSRAFGDYCVKDFGLISVPDVTQRHITSKDQFVVLAT
DGVWDVISNEEAVEIVSETPDRAKAAKHLVQCAVRAW
Predicted Coding Sequence 
ATGGGAAXATATGATGGTAGAGATGCTGTTGAAGCTATGGCTAAAGAAGCCAAGAGAAATGACTTGATATTAAGGTCTTCAGGGACTGTA
AATGTTGATGGTTCTAAGAATTTCGCTTCATTATTCTCAAGGAGGGGTGAAAAAGGCGTAAATCAAGATTGCTTCATTGTTTGGGAGGAA
TTTGGATGCCAAGAAGACATGACATTCTGTGGTATATTTGATGGGCATGGTCCTTGGGGTCATTTTGTGTCAAAGAAGGTTCGAGAATCG
ATAGTATCATCGTTGCTTTGCATTTGGCAGGAGAGTTTAGCTGAGGCTTCAGCTGATCCAGATTTGGATAAAAAGGCTCAAAGGTTTAAC
ATATGGAAGGAGTCCTTCTTAAAGGCATGTGCAACTGTGGATCAGGAGCTGGAACACCATCCCAAAATTGATACATTTTACAGTGGAACC
ACTGCTTTGACAATAGTCAGACAGGGTGAGGTTTTATTTATAGCAAATGTTGGTGACTCACGTGCAGTATTAGCTACCACGTGCGATGAT
GGCAACTTGGTACCAGTTCAGCTCACTGTTGATTTCAAACCTAATCTACCTCAGGAAACTGAGAGAATACTGCAGTGTAATGGTAGAGTA
TTTTGCTTAGATGATGAATCTGGGGTGCACCGATTATGGCTGCCCGACGAATCCTCCCCTGGATTGGCAATGTCTAGAGCCTTCGGGGAC
TATTGCGTGAAAGATTTTGGTCTAATTTCAGTGCCTGACGTGACACAAAGGCATATCACAAGCAAAGACCAATTTGTTGTGCTGGCAACA
GATGGGGTATGGGATGTTATATCGAATGAAGAGGCTGTAGAAATTGTATCTGAAACTCCAGATAGGGCAAAAGCAGCCAAGCATCTTGTT
CAATGTGCTGTTCGTGCTTGG
Edits in Original Sequence 
TAATGTCACTGTACAAAAATAAAACCAAACTCTGTTTGTCTCCTTTTCTCTTTCCCTTTAAAGGATCATAAACCAACGTAATCTTTTTAA
TGGATTCTCTTCTTTTCTCTCGATTTCTCAGCTCACCCCCTTCGAGTTTCCTCATTTGCCGGCAATCTTTTTCTGATTTTCCGACCTGTT
AATAACTCTCCGGCCATTTTCTCCGACCATATTCCACCGTAAAGTTAAACCAAAGGAGGGTATTTGGGTAGTTTAAATTAAAGAAAGTTT
GAAATGGGGCATTTTTCTTCAATGTTTAATGGATTAGCAAGGTCTTTTTCTTTGAAGAAAAGAAAGAATAGTTCTGGAA
(5')ATGGGAA
XATATGATGGTAGAGATGCTGTTGAAGCTATGGCTAAAGAAGCCAAGAGAAATGACTTGATATTAAGGTCTTCAGGGACTGTAAATGTTG
ATGGTTCTAAGAATTTCGCTTCATTATTCTCAAGGAGGGGTGAAAAAGGCGTAAATCAAGATTGCTTCATTGTTTGGGAGGAATTTGGAT
GCCAAGAAGACATGACATTCTGTGGTATATTTGATGGGCATGGTCCTTGGGGTCATTTTGTGTCAAAGAAGGTTCGAGAATCGATAGTAT
CATCGTTGCTTTGCATTTGGCAGGAGAGTTTAGCTGAGGCTTCAGCTGATCCAGATTTGGATAAAAAGGCTCAAAGGTTTAACATATGGA
AGGAGTCCTTCTTAAAGGCATGTGCAACTGTGGATCAGGAGCTGGAACACCATCCCAAAATTGATACATTTTACAGTGGAACCACTGCTT
TGACAATAGTCAGACAGGGTGAGGTTTTATTTATAGCAAATGTTGGTGACTCACGTGCAGTATTAGCTACCACGTGCGATGATGGCAACT
TGGTACCAGTTCAGCTCACTGTTGATTTCAAACCTAATCTACCTCAGGAAACTGAGAGAATACTGCAGTGTAATGGTAGAGTATTTTGCT
TAGATGATGAATCTGGGGTGCACCGATTATGGCTGCCCGACGAATCCTCCCCTGGATTGGCAATGTCTAGAGCCTTCGGGGACTATTGCG
TGAAAGATTTTGGTCTAATTTCAGTGCCTGACGTGACACAAAGGCATATCACAAGCAAAGACCAATTTGTTGTGCTGGCAACAGATGGGG
TATGGGATGTTATATCGAATGAAGAGGCTGTAGAAATTGTATCTGAAACTCCAGATAGGGCAAAAGCAGCCAAGCATCTTGTTCAATGTG
CTGTTCGTGCTTGG(3')AAACGTAAGAGGAGAGGGATAGCTGTAGATGATATTTCAGCCATTGTACTCTTCTTTCATTCTAAGCATTTC
TGTCAGCATATTTACCCTGTAACTACTCCAAAATAAGAAAACGCAAGTTTCTGTCACATGTTCTCCATCTTACCTGATTTTAGTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan