ESTScan Details for Unigene SGN-U578663

Score 
727
Direction 
Forward
Predicted Peptide Sequence 
XPNVWPVSGSNTGRXWRNPAYTAVRFIFTTFIALVFGTMFWDLGTKVSRSQDLINAMGSMYAATLFLGVQNSSSVQPVVAVERTVFYREK
AAGMYSAIPYAFGQVVIEIPYVFVQSAFYGVIVYAMIGFEWTAVKFLWYFFFMYCTLLYFTFYGMMTVAVTPNQNVASIVAAFFYAVWNL
FSGFIVPRPRIPIWWRWYYWACPVAWTLYGLVASQFGDIQTPLTDDENVEQYLRRYFGFKHDFLGVVAAVIVALPVMFALTFALGIKAFN
FQRR*
Predicted Coding Sequence 
XXGCCCAATGTATGGCCTGTCTCTGGAAGCAACACTGGTCGTXACTGGCGTAATCCAGCTTATACTGCAGTTAGATTCATTTTCACAACA
TTCATAGCACTTGTCTTTGGCACAATGTTTTGGGATCTTGGTACCAAAGTGAGTCGGAGTCAGGATCTTATCAACGCTATGGGATCTATG
TATGCTGCAACTCTCTTCCTTGGTGTACAAAATTCATCATCTGTCCAGCCTGTTGTAGCCGTTGAACGTACTGTATTTTACAGAGAAAAA
GCTGCTGGAATGTATTCTGCCATACCTTACGCCTTTGGACAGGTTGTCATCGAAATACCTTATGTATTTGTACAATCAGCTTTCTATGGT
GTCATCGTGTATGCAATGATCGGGTTTGAATGGACTGCTGTCAAATTCTTATGGTACTTCTTCTTCATGTACTGCACCCTCTTGTACTTC
ACCTTCTACGGCATGATGACAGTGGCTGTTACTCCAAACCAAAACGTTGCATCCATTGTCGCGGCCTTCTTCTATGCAGTATGGAATCTC
TTCTCAGGATTCATCGTTCCACGACCTCGTATTCCAATCTGGTGGAGATGGTACTACTGGGCTTGCCCTGTTGCATGGACCTTGTATGGT
CTCGTTGCATCACAATTCGGAGACATCCAAACTCCTCTCACCGATGATGAAAATGTTGAACAATACTTAAGACGTTACTTCGGATTCAAA
CATGATTTCCTTGGCGTTGTTGCTGCTGTGATCGTCGCGTTGCCTGTTATGTTTGCGTTGACATTTGCATTAGGCATTAAGGCCTTCAAC
TTCCAGAGAAGATAA
Edits in Original Sequence 
(5')XXGCCCAATGTATGGCCTGTCTCTGGAAGCAACACTGGTCGTXACTGGCGTAATCCAGCTTATACTGCAGTTAGATTCATTTTCAC
AACATTCATAGCACTTGTCTTTGGCACAATGTTTTGGGATCTTGGTACCAAAGTGAGTCGGAGTCAGGATCTTATCAACGCTATGGGATC
TATGTATGCTGCAACTCTCTTCCTTGGTGTACAAAATTCATCATCTGTCCAGCCTGTTGTAGCCGTTGAACGTACTGTATTTTACAGAGA
AAAAGCTGCTGGAATGTATTCTGCCATACCTTACGCCTTTGGACAGGTTGTCATCGAAATACCTTATGTATTTGTACAATCAGCTTTCTA
TGGTGTCATCGTGTATGCAATGATCGGGTTTGAATGGACTGCTGTCAAATTCTTATGGTACTTCTTCTTCATGTACTGCACCCTCTTGTA
CTTCACCTTCTACGGCATGATGACAGTGGCTGTTACTCCAAACCAAAACGTTGCATCCATTGTCGCGGCCTTCTTCTATGCAGTATGGAA
TCTCTTCTCAGGATTCATCGTTCCACGACCTCGTATTCCAATCTGGTGGAGATGGTACTACTGGGCTTGCCCTGTTGCATGGACCTTGTA
TGGTCTCGTTGCATCACAATTCGGAGACATCCAAACTCCTCTCACCGATGATGAAAATGTTGAACAATACTTAAGACGTTACTTCGGATT
CAAACATGATTTCCTTGGCGTTGTTGCTGCTGTGATCGTCGCGTTGCCTGTTATGTTTGCGTTGACATTTGCATTAGGCATTAAGGCCTT
CAACTTCCAGAGAAGATAA(3')AAGACACAACAAACTGTGTATATTGATCACAACTTTTGAAGAGCTTTTTGAAAAATTTTCTGTGTAT
TTTTTACCTTATTGAAAATTCATTCTAAGTTTTGTGTAAGAAATAATTAGTATATAAATGATATTATATTTTTTTTAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan