ESTScan Details for Unigene SGN-U578738

Score 
1175
Direction 
Forward
Predicted Peptide Sequence 
MANCDGRRIAIIGGGISGLLACKYAISKGFDPIVFESESSIGGVWSKTIESTKLQTPKPLYQFSDFPWPDSVTQVFPDQHTVLEYIKSYA
RHFDLVRHIQFNNKVLSLSYEDEDDREWMSKGKWNVTVQQTQTLSTKVYQVDYVVVCVGRFSQVPNIPEFPENKGPEAFEGKVIHSMDYS
KMDSTTATEFVKGKHVAVVGFQKSGLDIAMESSTVNGVERPCTVVVRTPHWNVPDYFPWGFPMAKLYLNRFSELTVHKPGEGLLLYLIAT
IXLASEVGLLKVCGKLYKTQAQAFKARDGARSSFLNELSACLISTVPQGFYDRVEEGRLKLKKAKSFGFTKQGIVLEGQAEPIKSDLVIL
ATGFRGIDKLKHIFESPKYQQLIAGSDDSAAVPLYRECIHPQIPQLAIIGFSESIANLYTSEIRCRWLAELLDGKFKLPSVKMMEKDIAE
WDKYKKRYSKKYYRRSCIGALHIWHNDQLCKDMGWNPKRKKGLWAEWFEPYGPMDYTGPI*
Predicted Coding Sequence 
ATGGCAAATTGTGATGGGAGAAGGATTGCAATAATTGGAGGTGGAATTAGCGGTCTCTTGGCCTGTAAATATGCAATTTCTAAAGGATTT
GATCCAATTGTGTTCGAGTCAGAAAGTAGCATCGGAGGTGTTTGGAGCAAGACGATTGAGAGCACTAAACTGCAGACACCAAAACCCCTT
TACCAATTCTCTGATTTTCCATGGCCAGATTCCGTAACCCAAGTGTTCCCCGATCAACACACCGTGTTGGAGTACATTAAATCCTATGCA
CGTCACTTTGATTTGGTGAGACACATTCAGTTCAATAACAAAGTATTGAGCCTTAGCTATGAAGATGAAGATGATAGAGAATGGATGTCT
AAAGGCAAATGGAACGTCACTGTACAACAAACTCAAACCCTATCCACAAAGGTATACCAAGTCGATTATGTAGTAGTTTGTGTGGGAAGG
TTCAGTCAAGTTCCAAACATTCCTGAATTCCCTGAAAACAAAGGTCCTGAAGCTTTTGAAGGGAAAGTAATCCATTCAATGGATTATTCA
AAGATGGACTCCACAACTGCAACCGAATTTGTCAAAGGAAAACATGTAGCGGTCGTTGGATTCCAAAAATCAGGACTGGACATTGCCATG
GAGTCCTCCACAGTAAATGGGGTTGAACGTCCGTGCACCGTAGTAGTCAGGACACCACATTGGAACGTTCCTGATTATTTCCCTTGGGGA
TTCCCAATGGCAAAACTCTATTTGAATAGATTCTCAGAACTTACAGTGCATAAACCTGGTGAAGGCCTTCTTTTATATCTCATTGCTACA
ATTCXTCTCGCCTCTGAGGTGGGGCTTCTCAAAGTTTGTGGAAAGCTATATAAAACACAAGCTCAGGCTTTCAAAGCACGGGATGGTGCC
AGATCAAGTTTCTTAAACGAATTGAGTGCCTGCTTAATTTCTACAGTGCCTCAGGGCTTCTACGACAGAGTTGAGGAAGGACGTCTCAAA
CTAAAGAAAGCCAAGAGTTTTGGATTTACCAAACAAGGCATTGTGCTAGAGGGTCAGGCTGAACCCATTAAATCTGACTTAGTCATACTC
GCCACAGGCTTCAGGGGAATTGATAAGCTCAAACACATTTTTGAATCACCAAAATATCAGCAACTCATAGCAGGCTCAGATGATTCTGCT
GCAGTTCCCCTCTATAGGGAATGCATTCATCCCCAAATTCCACAACTGGCAATAATTGGATTCTCAGAAAGCATAGCAAATCTATACACC
TCAGAAATAAGGTGCCGATGGCTGGCAGAGCTTCTTGATGGAAAATTCAAGCTGCCTAGTGTAAAGATGATGGAGAAAGACATAGCTGAA
TGGGATAAATACAAGAAGAGATACTCAAAGAAGTACTACAGGAGATCATGCATCGGTGCTTTGCATATTTGGCACAACGACCAACTCTGC
AAGGACATGGGCTGGAATCCTAAGAGGAAAAAGGGTCTTTGGGCTGAGTGGTTTGAACCATACGGACCAATGGATTACACAGGCCCAATA
TAA
Edits in Original Sequence 
TAAGTTTTGTGTATATCGCGCAATAGTTTTTGGAGTCTCCTTCATTGTTAGAAGAAAAAGAAAACCTTTCCTTATATATTTATATTTTTT
TATAAGAGTTTTGTTAAAAATAAATATAAGATTAATGATAAGTGTTGTTATAAATAGTGTTCCTAAAACTGAACCATCAATCGGCAAGTA
AGAGAGA
(5')ATGGCAAATTGTGATGGGAGAAGGATTGCAATAATTGGAGGTGGAATTAGCGGTCTCTTGGCCTGTAAATATGCAATTT
CTAAAGGATTTGATCCAATTGTGTTCGAGTCAGAAAGTAGCATCGGAGGTGTTTGGAGCAAGACGATTGAGAGCACTAAACTGCAGACAC
CAAAACCCCTTTACCAATTCTCTGATTTTCCATGGCCAGATTCCGTAACCCAAGTGTTCCCCGATCAACACACCGTGTTGGAGTACATTA
AATCCTATGCACGTCACTTTGATTTGGTGAGACACATTCAGTTCAATAACAAAGTATTGAGCCTTAGCTATGAAGATGAAGATGATAGAG
AATGGATGTCTAAAGGCAAATGGAACGTCACTGTACAACAAACTCAAACCCTATCCACAAAGGTATACCAAGTCGATTATGTAGTAGTTT
GTGTGGGAAGGTTCAGTCAAGTTCCAAACATTCCTGAATTCCCTGAAAACAAAGGTCCTGAAGCTTTTGAAGGGAAAGTAATCCATTCAA
TGGATTATTCAAAGATGGACTCCACAACTGCAACCGAATTTGTCAAAGGAAAACATGTAGCGGTCGTTGGATTCCAAAAATCAGGACTGG
ACATTGCCATGGAGTCCTCCACAGTAAATGGGGTTGAACGTCCGTGCACCGTAGTAGTCAGGACACCACATTGGAACGTTCCTGATTATT
TCCCTTGGGGATTCCCAATGGCAAAACTCTATTTGAATAGATTCTCAGAACTTACAGTGCATAAACCTGGTGAAGGCCTTCTTTTATATC
TCATTGCTACAATTCXTCTCGCCTCTGAGGTGGGGCTTCTCAAAGTTTGTGGAAAGCTATATAAAACACAAGCTCAGGCTTTCAAAGCAC
GGGATGGTGCCAGATCAtAGTTTCTTAAACGAATTGAGTGCCTGCTTAATTTCTACAGTGCCTCAGGGCTTCTACGACAGAGTTGAGGAA
GGACGTCTCAAACTAAAGAAAGCCAAGAGTTTTGGATTTACCAAACAAGGCATTGTGCTAGAGGGTCAGGCTGAACCCATTAAATCTGAC
TTAGTCATACTCGCCACAGGCTTCAGGGGAATTGATAAGCTCAAACACATTTTTGAATCACCAAAATATCAGCAACTCATAGCAGGCTCA
GATGATTCTGCTGCAGTTCCCCTCTATAGGGAATGCATTCATCCCCAAATTCCACAACTGGCAATAATTGGATTCTCAGAAAGCATAGCA
AATCTATACACCTCAGAAATAAGGTGCCGATGGCTGGCAGAGCTTCTTGATGGAAAATTCAAGCTGCCTAGTGTAAAGATGATGGAGAAA
GACATAGCTGAATGGGATAAATACAAGAAGAGATACTCAAAGAAGTACTACAGGAGATCATGCATCGGTGCTTTGCATATTTGGCACAAC
GACCAACTCTGCAAGGACATGGGCTGGAATCCTAAGAGGAAAAAGGGTCTTTGGGCTGAGTGGTTTGAACCATACGGACCAATGGATTAC
ACAGGCCCAATATAA(3')GATCATCATCCAACTTCCCCTTTCACGGGCTTTCTCTTTTGTTTTTACTTCTTCCTCGTCCTTGTTTTACA
AGTGTGATTTCTCATTTCTTTTCTTCTCTCTTCATTGCAAATAAATTCCACCCACCAAAGACAGCTTCACATTCATTCATGCTGTGTCCG
TGCAACACTTAAGGTAGAATGACAATACAACAGTGTTGTTTTCGCAGAAATCAACAGGTAGGCTTTAACACAG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan