ESTScan Details for Unigene SGN-U578756

Score 
1206
Direction 
Forward
Predicted Peptide Sequence 
XPSQRWIRSFIPLAPPSNASLGSCLPTSACSPPISLLGIYGGLLTIPQILLHYLSKVQTKILALHALFPPNHTSAHYXDATAVATGLKSV
ATTLPEVPKILAIPIASAPLPVPKSXPQSFPQFPILLNSIIDKVHNQLSLWPWNQNPFLNTQNQIPPMFTANHILKWHSFFYPSVSTTYT
VVPKTPELQLSYYHCNFCGVVAKKDFGVSIASSTSQFSSLSNNSESGPSSSSKKVEPTEEIRDLANDAIFEGXDMVVLKVGGLKNMVFEV
SXEVAGDETEQHEIGRMKLNFIFFDTQAGLNLRSDSLVSLISFVGFARSICFEAQLNYFSPYDMAQVSPQPIFKFGPKPNFPKSEIQTEI
SSLARRLATLSAATPAQFWPVISARSRVTAVKFYYMAECTLDLASSSSALSANLRISPTRLSPLRRSLALTSPSVAGKPLFCSHPHQRNS
VLSTNFSRSQFRTKSSMAETVSGESKAEVKVYDSDEELAVALAKYTADLSEKFCKERDVFTVVVSGGSLIKSLRKLVEPPYIDSIDWSKW
HVFWVDERVVPKDHPDSNYLLAYDGFLSKIPIPAGNVHAINDALSAEAAADDYETCLRHLVKSKILDISEESGFPKFDVMLLGMGPDGHV
ASLFPGHPLVHEKAKWVTFIKDSPKPPPNRITFTFPVINSSANIALAIVGAGKADVVHKSLGDDKSSDLLPVQMVSPEGELVWFLDKDAA
SKL*
Predicted Coding Sequence 
XCTCCATCACAGAGATGGATAAGGTCATTCATACCACTTGCTCCACCGTCTAACGCCAGTCTAGGTTCATGTCTGCCAACTTCAGCTTGT
AGTCCACCAATATCTTTGCTTGGAATATATGGTGGATTACTGACCATCCCACAAATTCTCCTTCATTATCTCTCAAAGGTTCAAACCAAG
ATCCTTGCTTTACATGCACTTTTTCCTCCAAATCATACCTCTGCACATTATAAXGATGCAACTGCAGTAGCAACAGGGCTTAAATCAGTA
GCAACAACTCTACCAGAAGTACCCAAAATCCTTGCAATCCCAATAGCAAGTGCACCACTTCCAGTCCCCAAATCAXGCCCACAATCCTTC
CCTCAATTCCCCATTCTCCTTAATAGCATCATCGACAAGGTCCACAATCAGCTCAGTCTCTGGCCTTGGAATCAAAACCCCTTCTTGAAC
ACTCAAAACCAAATCCCTCCAATGTTCACAGCCAACCACATACTGAAATGGCATTCTTTCTTCTACCCTTCXGTTTCCACAACATATACA
GTTGTTCCAAAGACGCCCGAACTGCAACTGAGCTATTATCATTGTAATTTTTGTGGGGTTGTTGCXAAGAAAGATTTTGGTGTTTCAATT
GCATCTTCAACAAGCCAATTTAGCTCCCTGAGCAACAATTCGGAGTCTGGACCATCGTCCAGTTCCAAGAAAGTGGAACCCACAGAAGAA
ATTAGGGATTTAGCCAATGATGCCATTTTTGAAGGTXCTGATATGGTTGTTTTGAAGGTGGGTGGCCTTAAAAATATGGTTTTTGAGGTT
TCAXCTGAGGTTGCTGGAGATGAAACAGAGCAACATGAAATTGGTCGAATGAAGCTCAACTTCATTTTCTTCGACACACAGGCAGGTCTC
AATCTTCGTTCGGATAGTTTAGTTAGCCTCATTTCTTTTGTTGGTTTTGCCCGCTCTATTTGTTTTGAGGCCCAATTAAATTACTTTAGC
CCATACGACATGGCCCAAGTAAGCCCACAACCCATATTCAAATTTGGCCCAAAACCCAATTTTCCCAAATCAGAAATTCAAACTGAAATC
TCGTCACTTGCTCGTCGTCTCGCAACTCTCTCAGCCGCTACTCCTGCTCAGTTCTGGCCAGTGATCAGTGCTCGCTCCCGAGTTACXGCT
GTTAAGTTTTATTACATGGCAGAGTGCACACTGGACTTAGCCTCCTCTTCTTCCGCTCTCTCTGCTAACTTGCGCATCTCACCTACCCGA
TTGTCTCCTCTCCGACGATCTCTTGCATTGACCTCTCCGTCCGTTGCTGGAAAGCCACTTTTCTGCTCCCACCCGCATCAGAGGAACTCA
GTGTTGAGTACAAATTTCTCGAGATCTCAGTTCAGAACCAAATCATCAATGGCTGAGACAGTGTCTGGGGAAAGTAAAGCGGAAGTGAAA
GTGTACGATTCCGATGAGGAACTTGCTGTGGCTCTAGCGAAGTACACTGCTGATTTATCGGAGAAATTTTGTAAGGAGAGAGATGTTTTT
ACTGTGGTTGTTTCCGGTGGTTCACTTATCAAGTCTCTCAGGAAATTGGTGGAGCCACCATATATTGATTCAATAGACTGGTCCAAATGG
CACGTTTTCTGGGTGGATGAGAGAGTGGTTCCAAAGGATCATCCTGACAGCAATTATTTGCTTGCTTATGATGGTTTTCTATCCAAGATA
CCTATTCCTGCTGGTAATGTGCATGCCATAAATGATGCATTATCAGCAGAGGCTGCGGCAGATGATTACGAGACTTGTCTAAGGCACTTA
GTCAAGAGCAAGATACTTGACATCTCTGAAGAGAGTGGGTTTCCAAAATTTGATGTAATGCTATTGGGTATGGGTCCAGACGGACATGTA
GCTTCCTTGTTTCCCGGGCATCCTCTTGTCCATGAGAAAGCGAAGTGGGTCACCTTCATCAAGGATTCTCCAAAACCTCCACCGAACAGG
ATTACATTTACATTCCCTGTAATAAACTCATCTGCAAATATTGCACTTGCTATAGTAGGTGCTGGTAAGGCAGATGTAGTGCATAAATCG
CTAGGTGATGATAAAAGTTCTGATTTGCTGCCTGTGCAGATGGTTTCACCTGAAGGAGAATTAGTTTGGTTTTTAGACAAGGATGCAGCT
TCGAAGCTGTAA
Edits in Original Sequence 
(5')XCTCCATCACAGAGATGGATAAGGTCATTCATACCACTTGCTCCACCGTCTAACGCCAGTCTAGGTTCATGTCTGCCAACTTCAGC
TTGTAGTCCACCAATATCTTTGCTTGGAATATATGGTGGATTACTGACCAgTCCCACAAATTCTCCTTCATTATCTCTCAAAGGTTCAAA
CCAAGATCCTTGCTTTACATGCACTTTTTCCTCCAAATCATACCTCTGCACATTATAAXGATGCAACTGCAGTAGCAACAGGGCTTAAAT
CAGTAGCAACAACTCTACCAGAAGTACCCAAAATCCTTGCAATCCCAATAGCAAGTGCACCACTTCCAGTCCCCAAATCAXGCCCACAAT
CCTTCCCTCAATTCCCCATTCTCCTTAATAGCATCATCGACAAGGTCCACAATCAGCTCAGTCTCTGGCCTTGGAATCAAAACCCCTTCT
TGAACACTCAAAACCAAATCCCTCCAATGTTCACAGCCAACCACATACTGAAATGGCATTCTTTCTTCTACCCTTCXGTTTCCACAACAT
ATACAGTTGTTCCAAAGACGCCCGAACTGCAACTGAGCTATTATCATTGTAATTTTTGTGGGGTTGTTGCXAAGAAAGATTTTGGTGTTT
CAATTGCATCTTCAACAAGCCAATTTAGCTCCCTGAGCAACAATTCGGAGTCTGGACCATCGTCCAGTTCCAAGAAAGTGGAACCCACAG
AAGAAATTAGGGATTTAGcCCAATGATGCCATTTTTGAAGGTXCTGATATGGTTGTTTTGAAGGTGGGTGGCCTTAAAAATATaGGTTTT
TGAGGTTTCAXCTGAGGTTGCTGGAGATGAAACAGAGCAACATGAAATTGGTCGAATGAAGCTCAACTTCATTTTCTTCGACACACAGGC
AGGTCTCAATCTTCGTTCGGATAGTTTAGTTAGCCTCATTTCTTTTGTTGGTTTTGaCCCGCTCTATTTGTTTTGAGGCCCAATTAAATT
ACTTTAGCCCATACGACATGGCCCAtAGTAAGCCCACAACCCATATTCAAATTTGGCCCAAAACCCAATTTTCCCAAATCAGAAATTCtA
AACTGAAATCTCGTCACTTGCTCGTCGTCTCGCAACTCTCgTCAGCCGCTACTCCTGCTCAGTTCTGGCCAGTGATCAGTGCTCGCTCCC
GAGTTACXGCTGTTAAGTTTTATTACATGGCAGAGTGCACACTGGACTTAGCCTCCTCTTCTTCCGCTCTCTCTGCTAACTTGCGCATCT
CACCTACCCGATTGTCTCCTCTCCGACGATCTCTTGCATTGACCTCTCCGTCCGTTGCTGGAAAGCCACTTTTCTGCTCCCACCCGCATC
AGAGGAACTCAGTGTTGAGTACAAATTTCTCGAGATCTCAGTTCAGAACCAAATCATCAATGGCTGAGACAGTGTCTGGGGAAAGTAAAG
CGGAAGTGAAAGTGTACGATTCCGATGAGGAACTTGCTGTGGCTCTAGCGAAGTACACTGCTGATTTATCGGAGAAATTTTGTAAGGAGA
GAGATGTTTTTACTGTGGTTGTTTCCGGTGGTTCACTTATCAAGTCTCTCAGGAAATTGGTGGAGCCACCATATATTGATTCAATAGACT
GGTCCAAATGGCACGTTTTCTGGGTGGATGAGAGAGTGGTTCCAAAGGATCATCCTGACAGCAATTATTTGCTTGCTTATGATGGTTTTC
TATCCAAGATACCTATTCCTGCTGGTAATGTGCATGCCATAAATGATGCATTATCAGCAGAGGCTGCGGCAGATGATTACGAGACTTGTC
TAAGGCACTTAGTCAAGAGCAAGATACTTGACATCTCTGAAGAGAGTGGGTTTCCAAAATTTGATGTAATGCTATTGGGTATGGGTCCAG
ACGGACATGTAGCTTCCTTGTTTCCCGGGCATCCTCTTGTCCATGAGAAAGCGAAGTGGGTCACCTTCATCAAGGATTCTCCAAAACCTC
CACCGAACAGGATTACATTTACATTCCCTGTAATAAACTCATCTGCAAATATTGCACTTGCTATAGTAGGTGCTGGTAAGGCAGATGTAG
TGCATAAATCGCTAGGTGATGATAAAAGTTCTGATTTGCTGCCTGTGCAGATGGTTTCACCTGAAGGAGAATTAGTTTGGTTTTTAGACA
AGGATGCAGCTTCGAAGCTGTAA(3')GGATGAGGATATGTGAGCTGCGTATTTGTGCTTCACTCCTCTGTGTATTTTATTATTCTAATA
ATACATTCTGAAGAAGGGTTGTCTGTAAAATGTTATGCCATTTTTTTCTCACTTGTTTCTGTAAGGATCCTTGACTATGAGGAACTTGGT
ACTAAAACTACAGTTTATTCTCCTATTACTATATTTTATCTATACAAGTTAGGCATGTGTACAGATTGTTTGC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan